Os11t0189600-02

Locus

Os11g0189600

Description

Similar to cDNA clone:J013062J12, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOSC7, OSC7, OsPS, PS, OsOSC7/OsPS, OsOSC7i, OsOSC7j

Oryzabase Gene Name Synonym(s)

oxidosqualene cyclase 7, "2, 3-oxidosqualene cyclase 7", parkeol synthase

Transcript Evidence

AK068026 (DDBJ, Best hit)

Protein Evidence

B7EC17 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: intramolecular transferase activity (GO:0016866)

Functional domain (InterPro)

Prenyltransferase/squalene oxidase (IPR001330)

Terpene synthase, conserved site (IPR002365)

Terpenoid cylases/protein prenyltransferase alpha-alpha toroid (IPR008930)

Squalene cyclase (IPR018333)

Full-length cDNA

J013131K12 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0189600-02)

Others

Oryzabase (10202)

Transcript

2560 bp

>Os11t0189600-02 Similar to cDNA clone:J013062J12, full insert sequence.
GGTCGGTAAACAATCTCCTCGGCCGGCAAGTGTGGGAGTTCGACCCTGACCTCGGCACGC
CAGAGGAGCGCGCCGATGTGGAGAAGGCGCGCCGCGAGTTCGCCGAGCACCGCTTCGAGC
GCAAGCATTCTAGCGACCTCCTCATGCGGATGCAGCACGGGAAGACGGCTAGCTACTTTG
GGCTGAGTCAGAGCTGTGCGCTAAACTGAACCTAATTCACACTAAACtacttcctccgtt
tcacgatTTCGCTAAAGAAAACTGTCAAAAGCTGGACCTTCTCGCTGTCAAGCGTGGAGA
GCACGAAGACGTCATGGGGGAAGCTGTGTGGAGCTCTTTGAAACGGGCCATAAGCCGCGT
TTGTAATTTGCAGGCACATGATGGACACTGGCCCGGGGATTATGCAGGACTTATGTTCTT
TTTGCCTGGCTTGATTATAACATTGCATGTCAGTGGAGTTCTGAACACTGTTTTATCATC
GGAACATCAGAAGGAGATGCGCCGGTACATCTATAATCACCAGAATGAAGATGGAGGGTG
GGGGTTGCACATTGAGGGCCACAGCACCATGCTTGGCTCATCCCTGAACTATGTTGCTTT
GAGATTGCTTGGGGAGGGTCCAAATGGTGGAGATGGATGCATAGAGAATGGTCGAAACTG
GATTTTAGATCATGGAGGAGCCACATTTACGACATCATGGGGGAAGTTCTGGCTCTCGGT
ACTTGGAGTATTTGATTGGTCCGGTAATAACCCAGTGCCACCAGAGTTATTACTATTGCC
GTATCAACTGCCGTTTCACCCAGGTCGAATGTCGAGCTATATCCGAATGGTGTTTATACC
CATGTCTTACATTTATGGAAAAAGGTTTGTTGGCCCAGTAACACCAGTTGTGCTAGAGCT
AAGAAGTGAACTATACAATGACCCCTATGATGAGATTGACTGGAACAAAGCTCGTACTCA
GTGTGCAAAGGAAGATATGTACTATCCACGTTCATCCAAACTGGATATGTTTTGGTCCTT
TCTCCACAAGTTTATTGAACCAGTTTTGTTGCGCTGGCCTGGGAGAAAACTGAGGGAGAA
AGCTCTGGCCACTTCCATGAGGAATGTTCACTATGAAGATGAGTGCACTCGATACATCTG
TTTCGGTGGTGTACCCAAGGCATTAAATATCCTTGCTTGCTGGATTGAAGATCCAAGCTC
AGAGGCATTCAAATGCCATATTGCACGCGTATATGATTATTTATGGATCGCTGAAGACGG
CATGAAGATGCAGATTTACGATGGCAGCCAGGTGTGGGACGCAGGTTTGACAGTTGAGGC
CCTTGTGGCTACTGACCTTGTCAAAGAGCTTGGACCAACTCTTAAACGAGCGCATTCCTT
CCTTAAGAATTCGCAGTTGCTTGACAATTGCCCCCGAGATTTCAACCGCTGGTATCGCCA
TATATCCAAAGGTGGATGGACATTTACAACAGCTGATGATGGCTGGCAAGTTTCAGATTG
CACGGCGACAGCACTGAAGGCATGTCTATTGTTATCAAGGATATCTCCTGAAATCGTTGG
TGAACCACTGGAAATTGATGCACAATACGATGCTGTTAATTGTCTGATGTCTTTGATGAA
TGATAATGGTGGCTTTTCAGCATTTGAACTCGTAAGGTCTAATACATGGCTGGAGCATAT
TAATCCTACAGAGGCATTTGGGCGTGTAATGATTGAATATCCGTATGTCGAATGTACATC
ATCATCAATTCAGTGTCTAGCATTATTCAAAAAACTTCACCCAGGGCACCGCAAGGAAGA
GGTGGAAAATTGTATCAGCAAAGGTGCTAATTTCATTGAGAGTTCTCAGAGAAGCGATGG
TTCATGGTATGGTTCTTGGGGGATTTGTTTCACCTATGCCACATGGTTTGCAGTGACAGG
ATTAGTTTCTGCAGGCAGGACACTTGGGAATAGCGCTACAGTTAGAAAGGCATGTGACTT
TCTCTTGTCAAAACAGCTTCCTTCGGGTGGCTGGGGCGAGAGCTATTTGTCATGTCATGA
CGAGGTTTACACAAATCTTAAAGGCAACCGACCTCACGGTACGCACACTGCGTGGGCCAT
GATTGCACTAATTGATGCAGGGCAGGCTGAAAGAGATCCAGTGCCTCTGCATCGAGCAGC
CAAGGCTTTGCTCAACTTGCAATTAGAGGATGGAGAATTTCCACAGCAAGAAATTGTTGG
AGTCTTTCTCCAAACTGCCATGATCAGTTATTCCCAGTACAGGAACATCTTCCCTATAAT
GGCTCTCACAGGGTATCGCCGCCGAGTACTGCTTGCAGGCAACATATAGGAGCATGATTT
TAAGTTATGCCAGCTCTTGGCATGTTGGTTTGCCAATAAAGTTACATTTCACCTCCCCTA
GCAGCAGTACTCTCTACTGTTCTAGCGTTTGTATTTTGTATTTTCTAAGAAAAAAATGTT
TTACCGCATTTACTTAGTTCCCTTTGTTTGTAATAAAACATGGAACATACTGCTTCCTTG
TAGTTACACGTGCGTTCTAATAAGAAACATTATTATATCT

CDS

2016 bp

>Os11t0189600-02 Similar to cDNA clone:J013062J12, full insert sequence.
ATGGGGGAAGCTGTGTGGAGCTCTTTGAAACGGGCCATAAGCCGCGTTTGTAATTTGCAG
GCACATGATGGACACTGGCCCGGGGATTATGCAGGACTTATGTTCTTTTTGCCTGGCTTG
ATTATAACATTGCATGTCAGTGGAGTTCTGAACACTGTTTTATCATCGGAACATCAGAAG
GAGATGCGCCGGTACATCTATAATCACCAGAATGAAGATGGAGGGTGGGGGTTGCACATT
GAGGGCCACAGCACCATGCTTGGCTCATCCCTGAACTATGTTGCTTTGAGATTGCTTGGG
GAGGGTCCAAATGGTGGAGATGGATGCATAGAGAATGGTCGAAACTGGATTTTAGATCAT
GGAGGAGCCACATTTACGACATCATGGGGGAAGTTCTGGCTCTCGGTACTTGGAGTATTT
GATTGGTCCGGTAATAACCCAGTGCCACCAGAGTTATTACTATTGCCGTATCAACTGCCG
TTTCACCCAGGTCGAATGTCGAGCTATATCCGAATGGTGTTTATACCCATGTCTTACATT
TATGGAAAAAGGTTTGTTGGCCCAGTAACACCAGTTGTGCTAGAGCTAAGAAGTGAACTA
TACAATGACCCCTATGATGAGATTGACTGGAACAAAGCTCGTACTCAGTGTGCAAAGGAA
GATATGTACTATCCACGTTCATCCAAACTGGATATGTTTTGGTCCTTTCTCCACAAGTTT
ATTGAACCAGTTTTGTTGCGCTGGCCTGGGAGAAAACTGAGGGAGAAAGCTCTGGCCACT
TCCATGAGGAATGTTCACTATGAAGATGAGTGCACTCGATACATCTGTTTCGGTGGTGTA
CCCAAGGCATTAAATATCCTTGCTTGCTGGATTGAAGATCCAAGCTCAGAGGCATTCAAA
TGCCATATTGCACGCGTATATGATTATTTATGGATCGCTGAAGACGGCATGAAGATGCAG
ATTTACGATGGCAGCCAGGTGTGGGACGCAGGTTTGACAGTTGAGGCCCTTGTGGCTACT
GACCTTGTCAAAGAGCTTGGACCAACTCTTAAACGAGCGCATTCCTTCCTTAAGAATTCG
CAGTTGCTTGACAATTGCCCCCGAGATTTCAACCGCTGGTATCGCCATATATCCAAAGGT
GGATGGACATTTACAACAGCTGATGATGGCTGGCAAGTTTCAGATTGCACGGCGACAGCA
CTGAAGGCATGTCTATTGTTATCAAGGATATCTCCTGAAATCGTTGGTGAACCACTGGAA
ATTGATGCACAATACGATGCTGTTAATTGTCTGATGTCTTTGATGAATGATAATGGTGGC
TTTTCAGCATTTGAACTCGTAAGGTCTAATACATGGCTGGAGCATATTAATCCTACAGAG
GCATTTGGGCGTGTAATGATTGAATATCCGTATGTCGAATGTACATCATCATCAATTCAG
TGTCTAGCATTATTCAAAAAACTTCACCCAGGGCACCGCAAGGAAGAGGTGGAAAATTGT
ATCAGCAAAGGTGCTAATTTCATTGAGAGTTCTCAGAGAAGCGATGGTTCATGGTATGGT
TCTTGGGGGATTTGTTTCACCTATGCCACATGGTTTGCAGTGACAGGATTAGTTTCTGCA
GGCAGGACACTTGGGAATAGCGCTACAGTTAGAAAGGCATGTGACTTTCTCTTGTCAAAA
CAGCTTCCTTCGGGTGGCTGGGGCGAGAGCTATTTGTCATGTCATGACGAGGTTTACACA
AATCTTAAAGGCAACCGACCTCACGGTACGCACACTGCGTGGGCCATGATTGCACTAATT
GATGCAGGGCAGGCTGAAAGAGATCCAGTGCCTCTGCATCGAGCAGCCAAGGCTTTGCTC
AACTTGCAATTAGAGGATGGAGAATTTCCACAGCAAGAAATTGTTGGAGTCTTTCTCCAA
ACTGCCATGATCAGTTATTCCCAGTACAGGAACATCTTCCCTATAATGGCTCTCACAGGG
TATCGCCGCCGAGTACTGCTTGCAGGCAACATATAG

Protein

672 aa

>Os11t0189600-02 Similar to cDNA clone:J013062J12, full insert sequence.
MGEAVWSSLKRAISRVCNLQAHDGHWPGDYAGLMFFLPGLIITLHVSGVLNTVLSSEHQK
EMRRYIYNHQNEDGGWGLHIEGHSTMLGSSLNYVALRLLGEGPNGGDGCIENGRNWILDH
GGATFTTSWGKFWLSVLGVFDWSGNNPVPPELLLLPYQLPFHPGRMSSYIRMVFIPMSYI
YGKRFVGPVTPVVLELRSELYNDPYDEIDWNKARTQCAKEDMYYPRSSKLDMFWSFLHKF
IEPVLLRWPGRKLREKALATSMRNVHYEDECTRYICFGGVPKALNILACWIEDPSSEAFK
CHIARVYDYLWIAEDGMKMQIYDGSQVWDAGLTVEALVATDLVKELGPTLKRAHSFLKNS
QLLDNCPRDFNRWYRHISKGGWTFTTADDGWQVSDCTATALKACLLLSRISPEIVGEPLE
IDAQYDAVNCLMSLMNDNGGFSAFELVRSNTWLEHINPTEAFGRVMIEYPYVECTSSSIQ
CLALFKKLHPGHRKEEVENCISKGANFIESSQRSDGSWYGSWGICFTYATWFAVTGLVSA
GRTLGNSATVRKACDFLLSKQLPSGGWGESYLSCHDEVYTNLKGNRPHGTHTAWAMIALI
DAGQAERDPVPLHRAAKALLNLQLEDGEFPQQEIVGVFLQTAMISYSQYRNIFPIMALTG
YRRRVLLAGNI*

5'UTR

chr11:4522486..4522640 (+ strand) : 155 bp

chr11:4522735..4522826 (+ strand) : 92 bp

chr11:4523065..4523130 (+ strand) : 66 bp

CDS

chr11:4523131..4523250 (+ strand) : 120 bp

chr11:4526689..4526775 (+ strand) : 87 bp

chr11:4527223..4527420 (+ strand) : 198 bp

chr11:4527529..4527613 (+ strand) : 85 bp

chr11:4528760..4528926 (+ strand) : 167 bp

chr11:4532276..4532464 (+ strand) : 189 bp

chr11:4545956..4546069 (+ strand) : 114 bp

chr11:4547915..4548037 (+ strand) : 123 bp

chr11:4548148..4548270 (+ strand) : 123 bp

chr11:4550758..4550856 (+ strand) : 99 bp

chr11:4550985..4551041 (+ strand) : 57 bp

chr11:4551583..4551629 (+ strand) : 47 bp

chr11:4551726..4551869 (+ strand) : 144 bp

chr11:4551969..4552146 (+ strand) : 178 bp

chr11:4554020..4554100 (+ strand) : 81 bp

chr11:4554173..4554256 (+ strand) : 84 bp

chr11:4557561..4557680 (+ strand) : 120 bp

3'UTR

chr11:4557681..4557911 (+ strand) : 231 bp

FASTA

>Os11t0189600-02 class=Sequence position=chr11:4522486..4557911 (+ strand)
GGTCGGTAAA CAATCTCCTC GGCCGGCAAG TGTGGGAGTT CGACCCTGAC CTCGGCACGC CAGAGGAGCG CGCCGATGTG
GAGAAGGCGC GCCGCGAGTT CGCCGAGCAC CGCTTCGAGC GCAAGCATTC TAGCGACCTC CTCATGCGGA TGCAGGTTCG
TCCATGTCCA CGACACATCC ATCGAGCACA TCTTCTCGGT CCTGTGGTCC TTGGCGCAAC CCGTTGTACA AAATATTTTT
CATTTCCAGC ACGGGAAGAC GGCTAGCTAC TTTGGGCTGA GTCAGAGCTG TGCGCTAAAC TGAACCTAAT TCACACTAAA
Ctacttcctc cgtttcacga tgtaagtcat tctagtattt cccacattta tattaatgct aatgaatata gacatatgtt
tatatctatc tagatttatt agcatcaata taaatgtgag aaatgttaaa atgacttaca ttgtaaaaca gaggaagtaC
TTAACTTCTC TTGTAAAATT GGCACTGAAA AAAAAAACAT ACACTGTTCT GTGCTCATGA CCACACTGAC TCTCTTACCT
TCTGCTCTCT ATTTTGCAGT TCGCTAAAGA AAACTGTCAA AAGCTGGACC TTCTCGCTGT CAAGCGTGGA GAGCACGAAG
ACGTCATGGG GGAAGCTGTG TGGAGCTCTT TGAAACGGGC CATAAGCCGC GTTTGTAATT TGCAGGCACA TGATGGACAC
TGGCCCGGGG ATTATGCAGG ACTTATGTTC TTTTTGCCTG GCTTGGTACC TGCTCCATCT TGTTTTatct atctattata
ttattaaaac agctttaaaa agagacatca tattcgctgt ggaacctaga aattactaca ttaatcaaag aaaaagaaaa
aATATTAACC ACGTTAGATC ATGGTAGATC CATATTTTAA TGGTCTTAGA TTGATACAGC AGGAAAAGCA ATGGATATAG
ACTCCCGCAT ATAGAGTCAT ACAAGGATAG AGTCTGACCA TATCGACTAA ATCGAGCCCT CATAGTAGAA GTCATACACG
TAAAAAAAAA GGCATCTGCA TCTCCCGCGT ATGCAAATAT ATTCTGAGTT TTCTTCGTCC TTATCACTTT ATGTTCTTCC
CTCAAACATA TATCTCTATT GGTTTGATGC ATTATCTTAA AAAATATTCT ATTTGTGTCT ACGTTTGCAC AAAAATAATG
TTAGGTCTTT AAATGATTTT CTAAAAAAAA ATATTAGTTT CATATGTTCT TCCTGTCAGC GAAGgaaaaa aaaagataaa
atttaagtag gaatacaatg tataaataac caattttttt taaaaaaagg taaaattgaa atagcataca tctagaaaac
aacacgagat taattaaaat ttagaataga aaataaaata aattctaaac tggattttca gtacaaaatt caaataaact
ttaaaaaaca ataaaattca aaacaaaata taataaaata attatATAAG TAAAGACTAC ATAGCAAGAA TAATGAGTTT
AAGTAGGATT ATAATTTAGA TCGTGGTCGG TCTAGATTTT AACGGTTGAG CTTCAATAAG AGTCCACAAA AAGTTCTGGA
AAATTACAGT CGTCTATCTA AAGTGCATTA GAAACAGATA CATCGGTACA TTGCAACGAC AGACTACGAC TCGGatatgt
acaaaaaatt caaacaaatt aagtagaaaa attggaataa taaatcaaat aaattccaaa tttggatttc aacacaaatt
ctaaataaac tttaaaatca ttaaaggatc aaaataaaaa ctcactttgg atggtagata gtcccacatt aacctgagta
aaaataaaga agagttcaag tagaaatata atttaaaaat atactatgtt tgttttagat attagaaatt ctcacattaa
ttgaaggcaa agagaaaata tccttagaaa taattgaata caaaacaaaa ttatatcctt agaaataata gaaagggttg
taaaaagagg aattaagaaa aggttgCATA ACTGGTGGGC ATCCTAATAC GATTCGGACT ATTATGAGGA CTTTAGCCTA
ATGGAATTTT TTTTCTTTAA AAAAAAAAGA CTCGAGACCT GCTAGAAAAA ATGAGGGCTT TCCGATAGGG GGAAAATGCA
GAGGCGTTGT TCGATCAGGC TGAACTGCTT AAGGCTCATG TACAGGCATT CAGCCCTACA TTGCAGCCAT ACATCGATTG
TCTCATTAAA ATTTGAAATA AAAAATACAT TGTAAAATTG GATTTCAATA CGAGTTTCAA ATAAACTTAA AGAATCATTA
AATTCTGAAA TGAAAATACA GTATCAAAAA CTACCAGAGG ACGATGACAG GAGGAAAACG AGTAAGATAG AGGATACGGT
GCTGACCATA TATGTGGGAC TTCTATTGTA ATCACAGCGA TAATAAGTTT AATGAAAATA TAATATCAAG AACTACCAGA
GGGTGATGAT AGGTGGAAAG CGAGTAAGAT AGGGGTTACG GTGCCGACCA CATATGTGGG ACTTCTATCG TAATCACAGC
GACAATAAGT TTCAATTTTG AATGGCACTA AATGATAAAG AAAAATAAAG ATGGCATGGC TTGACGAGTG GATAGACGAA
AAAGGGGTAG GGAGGCAGTG GTTTCCATGG GAGAGCAAAC CGAGAAGCAA CAAATGAGTA AAGCAATGGT GGCGGTGTCT
AAAAACTATA AAAGGAAACC CGGACAATGC TAAGGTTCAA TTTTATAAGT GCCGATGACA ATAAAGATGA AAACAGCAGC
ACTGGTAGAT AAGTGGATGG GTGACAAAGG AGCAGGGAAA CGACGATTTG CCATCAAAGA GTGAGCTGAG GGATGGCAAA
TGACAATAAA TAGGGGGAGC AACAAATGAA CTGTAAAGGA GTACATCTAA ATATTgtaaa aaaaacctca attacaacta
gattcaattt taagaatccc aatgttgata aagagtaagt gtagcagata ggtcataaag gtgtaggttt atggcggttg
actggactac tagaaagtaa aagagtaaac gcacaataat caggttttat tttcaaattt ccaataagaa taaagagggg
agggggcaat aagcggacat taaaggagta gggtgacgat atttgactgg acttctaaaa tttctaaaaa catagcctga
taagacaata aactctgaaa cctataagat ccaattattt taaaagtgga tgaacataga agtcatggag ggccggataa
acaattaagc ggccagttaa ggagtaaggg gtggtggttg atgtgactca aaaatataaa attaaaaact cgatgatcaa
gaggttcaac ttttataaag tcctaagaga atgatattat tatttaatag ttcttataga aaattatgtg taaaaggatt
ggaaaatttt atctgggtgc tagccgcgta attgtgtggg TTATTGTATT CCATGACACA CCGTGCTATT TTGATAATTA
CCCACGTCAC GACCTGGGTG CATTTAATTT TGTATAGGCA GAATGCACCC ACCCTCTAgg gtgtttggtt cgtagggact
aaaatttagt ccctttcgca tcggatattt agacgctaat ttggagtatt aaacatagac taagtacaaa acttattctg
taacattgga ctaattcgcg agatgaatct attgagctta attaatccat gattagccta tgtgatgcta cagtaaatat
ttgctaatta tggattaatt aggcttaaaa aaattcatct cgtggattag ctctcatttg tgaaattagt tttttattag
tctatgttta atattctaaa ttattatata aacatccgat ataatagtaa ctaacaaaat tttagcgcca tctaaaAATT
GCAGTTTTGT TGTAACTGCT CGATCCAAAT TGCAACTCGA ACCGTTGCAA CCGGCTCCAT CCGAGTTGGA ACCAGCTCGG
TCCGAGTTGC AACTGGTTTG GTCCAATTGC AATCGTTGCG TCAAGCTGCA ATTGGCCTAG TCTCTCGGTT GCAACTGCAG
CGTACGTGCA TTCTGAATAG AGAATGCAAC TGGGTGCATT TTAACCTCAT ATGTTATTGA TTTTTCAGTT CTTGCTAGGT
AAGAAAGCTG CTCATCATTA TGTTTTGACT CGCATGTGCT CAGATTATAA CATTGCATGT CAGTGGAGTT CTGAACACTG
TTTTATCATC GGAACATCAG AAGGAGATGC GCCGGTACAT CTATAATCAC CAGGCAAGGT TACTTTAATT AATTTGTTGA
TAAACTTTAC AAATTCTATG CTGCGAGAAA GCAAATTCAT TACTTTTCGT GAATATATGT TGGAAATTGA ACTTACCACA
GCATCAATGT GAACAGATCT CGTTTGTGCC ACATGCTAAT GCAACCACAT TAAACAAATT AATGTGACTA GCTAGAACAT
CTCCACCTAA GGTTGTTCTC AGCTGCCCCT CTTTCCAACA CCTCTCTCGt ttttcacgcg tacgcttttt aaactgctaa
acgatgtgtt tttttgcaaa aaagtttcca tacgaaagtt gcttaagaat ggaattaatc cattttttaa aaaaatagta
aatacttaat taatcaccca ctaatcgctg ctccgttttt ACAAGATTCA AACATGCATG CATAAGTCTA GATTATTCCT
AACAATATAT ATAATTGCAG AATGAAGATG GAGGGTGGGG GTTGCACATT GAGGGCCACA GCACCATGCT TGGCTCATCC
CTGAACTATG TTGCTTTGAG ATTGCTTGGG GAGGGTCCAA ATGGTGGAGA TGGATGCATA GAGAATGGTC GAAACTGGAT
TTTAGATCAT GGAGGAGCCA CATTTACGAC ATCATGGGGG AAGTTCTGGC TCTCGGTATG GGATTAATAC ACTTCTTTGT
TTATGGCATT TATGCCATTT CAAACTTTTT CAAATTGGTT TTATAGAGAA GCTTCCGTAG TTTCATTTCA CTTATTATCT
CAGGTACTTG GAGTATTTGA TTGGTCCGGT AATAACCCAG TGCCACCAGA GTTATTACTA TTGCCGTATC AACTGCCGTT
TCACCCAGGT AGTACTGCTT GCTTTCTTGA GGCATCATAT TCATGCACGT GTTGTATAGG GAATGTGTTT GGGGTTAGCC
CCAAAAAATC TTAGTCGCAA CTTAAATTTA GGAAAACCTG GGGTGTTTGG ATTGTAGCTA TGCCAACACT ATCAGTATAT
ACCATATATA TGGGCCTTAT GTCAGCTCTA TGGACAGCCA CCATGTACGA GTAGTCTAAT TCGCGACTAG TCGCGCTAGC
TCTCCCGCGC GACTGACGGC GTGTCGCACG CAGAGAGGAG GCGGCGAATG CGCGTACGGT TTTGTTTTTT TTTTTCTGTT
TTTTCTCTTC CGTATCCTCT CCAGTTTTCT TTTTTTCTTT TTTTTCTTTT CCGTATATTT TTCCGTTTTC TCGGTTTTGT
AATACGTATG TATGTAAACT TTGTATACAC GTATTTTTTG GTTTTTTATA CGTAAGCCCA CAAACTTTAT ATACATATGT
ATATTTTTAT ACATTAAAAG TGTATACATA Tgtacgtata caaagtttgt gtacgagtat acaaactttg tatatgtgta
caaactttat atacgtgatg tattttttta tttttaatat gtacatatat aaagtttgta cgtcgtatat aaactttgta
tacatatgca acatatacaa agtttatata catgtatata ttttttataG TAGTAGTACT AGTAGGACTA TAGTATAGTA
GCAGTAATAC TGGTAGTAGT ACCGTTGTAG TAGCACTGCA TGAGAAGGTA GTACGGTATT TAGGGGTGGC CGCGCGCCTA
ACACCACCCC CCCCTAAAAA AACCATGTAC ACCCTCTCTC CATAGTACAC GCGCGCGCAA ACACATATCC GTATGGCACC
TCTAAACACT GTACGTTGTG CACATGTCAT CTGAATTTCA CAATGCGTAT CACCACTATA GCTCATGTAC AGATCAACAC
ATAAGAGAGG AAATTAATCT TATTAGCTAC GACTAGAGAT CAATGAATGA GCCTCCATCT AGGGTGAAAA TTAAATTATC
TTAATACGGC AGATTATTCA ACTGCAATAC ACCGAATTGA TAAATGCTGA AGTTTCTATG TTGTTGGCCA TTCATTGATA
ATATGATGTA TTACTGATTC ATAACATAAT GCAGGTCGAA TGTCGAGCTA TATCCGAATG GTGTTTATAC CCATGTCTTA
CATTTATGGA AAAAGGTTTG TTGGCCCAGT AACACCAGTT GTGCTAGAGC TAAGAAGTGA ACTATACAAT GACCCCTATG
ATGAGATTGA CTGGAACAAA GCTCGTACTC AGTGTGCAAA GGTTGGTACA GAAAATTGTG TAGAATAAAG CTCGTAGTCA
ATGTACTGTA CTATTTTTAT TAATGTACTG TACCACTAGA AAACTGTTGT TTGGAAAATA TATTAACAAA CTATTTGCTA
ATTACATAta ctacctcggt tcttaaatat aagacgccat tgattttttt cattcatttg agttttcatc tttccggcaa
atatttattg aaatagacaa atatatttgt aaaccataaa atagttctga tgttagatct aatgttaccc atttcacttt
acactaattg attaaataaa tattgtgagt catttgagta agaagttaat ggtattatac atttaagagc ggaggtagta
CTTGACATTA ATGTATTGTA CCATTAAAAT ATTGTTGAAT CACGACAAAC TATTGGCTAA TTACACATAC TTTAAAACAA
ATATAGCTCT ATAATTAGCG TCTTGATCGT CTCACCAGAA TATACAAAGC AACTTCATAG TTGCATATAT ACTATCTCCT
TTGTAAAAGT GTAAAGTTTA GGATAAGGTT TTTAGCTCTT TTAAAACTAA TTAGCTTGTC GTAAATCTCA TGTATTAAAG
ATTGAAGGTA GTAGAGGAAT AATTACACAG AAAATTATCT ACAAGTTGTA TATGTATTGG ACTTGCACTA CAAGAAACCA
GAATATCCTT AGCGGCcaaa aacagtttgt ttcggttatt tttatatgac tttgtttcaa cagtttgaat ttaaatttca
aatgatgaca acttcaaaca acgttttcaa atagtaaatg atttcaactg aaaaaatcat caacaacaaa gtggcataac
tcatcaagat ctataacttc tattttggtc atttcttcat ccgacaaagt gatttgtaac attgttcaca aaatgtacat
atctcctata tagttttata aactataaga gagatataca aattttggga aaaatgttac tatcattttg tcggatgaag
aaatgactaa aatataagtt atatatcttg atgagataac ttttttagtt gaaatcattt actgctttaa aATATTATTT
AACTCccatg agttaaaatt ttacgagtta aaattttact gggagttaaa ttttaactca tgagtgaATC TGCTGTTGGA
TGGGGAGGGA ATGGACGGTT GAGATTGAGA TCGCGGGAGA AGGTGTGGAT CGATGATGTG GCGTGAGGCG CAAATCGGTG
ATTTGGCACT TGGCGGGAAT TTTTGACCTG CAGGTGCACG TAAAAATATG AAATTATCTT GGCGGCTATT TCCAACCGCC
AAGGAAATAT GTACTAAGCA AACTATATAT TTCCTTGGCG GTTGGAAATA GCCACCAATG TTTTGCTTAG CGGCTAATTT
GAACCGCCAA ATTAAAATAT AATCTTGGTG GCTGATTTTA GACCGCCAAG AAAATTGCAT GGCCACCAAG CCACCAAGGA
TATTCTGTTT TCTTGTAGTA ATTGTATGTT GTCGATGCAC AGTTTGGTAG AATAAGATCA TTGGTCTTCC TAAGAATAGG
TGAAAAAGTA TCAACTATCT GTAAAATGGA ATTGAAATAA TTTATTTATA AAATAATACC ATGGAATAAA TATTCTTATG
GAAGGATCAT TCTGTGAATG ATATAATTCA CATCAATCAG ATGAAAATTT ATAAAAATGC ATTTTCTATG AATACATACA
CTACTATACA GAGCTAATTA TATAGCAGAT CACTGACACC TTATTTTATC AAATGAATAT TGATGAGCCA GCATTCATGA
ACTGGAAGTG ATTAGCCATG ATCTATTGAT GACAGTTCTT GGTAGACTGT TGGTGATAAA GACAATGTCA CTGATGGTTC
TTACTTGATA GTGTCATTCT AACTCCGCAA AAAAAAAAGT CATACGAGGA TTTTGTAGGA GATATTAACA AAGAAGTGAA
GTGATCTTCC TTTGCCCCTA TTTACTAACG AAAGGGCATG TAGCCTgacc tgagtagtac cggtcctgaa ttcaaatatc
ctatggagcg aatttcagat tgagttgttt gcggggctaa gttccctatt tcaatgaccg tatatatccg gttggatgta
taggcctggt aaaaaatacc cttctctaaa aaaaaAGTCA CGTTACTAAT TGTTGAAAAA CATATAGGGT GTGTTTCGCC
ATGAGCACTC AATGGAAACA ATGAATATAT AAGACATCAA TAATTATTGA ACATTTTTTC CCTGAAATTG TAGGTTGCTT
GCAATCAAGA GATTTAAAGT TTGACTATAA ATATTATTTT TAATATTTCA AATATACCTT TGAAAATAGC ATAACTAGAT
TTTTTCTTGA AAATGAATTT AGCAACTGTC CTACTATATC ACTAATTTAT AGTCTATGTA GTATGTTGGG TTCCTTGTCT
AGTAAAAATG GCACTCTGTT TTAAACAGAT AGTAGTTACA ATGTTGCTGT GAATTTTGGC TAAATTAACA ACGAAATGTA
GCACAAGTCA ATGCAGTAGG GTTTGTCTGA AATTCCCTTG CAGCCTGACT GCATATGAAA ACACCTTACA CTAATGTAAT
AGGATTAACC AGGAAGTCCC ATTTTTTAGA GTGCATAGGA TGTAATAAGT TAGCCTCGAC CTATCTAAAC TTTCAGTGTG
ATCCAAAATC AGACAACAAA AATTAACAAA TTAAAATGGG CCTTGCCCAT GGTCACCTCA ATAAATGTTA ACAGTCAAAC
TATTACAAGT GTTGGCGTCA CTCTACAGTA AATAGTCTAC ACAAATAATA GTCCTTATTC CTTTTCATCA AGAACACACG
ATATTCAGTG ATCAATATGA CTATTTACAG ATTTTAACTG GCAATATAGT TAAGTGCATC TTTCATACGA ATGTCTCCTG
AAGTATATTT TCCATATCAG ATAGTAATTG AGCACAAAGC AGTTGAGTGA CATGAGAATT AATTATActc ccttggttcc
agaatataag tatttttagt atagtgacaa gtcaaatatt tttaactttg gctattaata aaaaaataaa gaatatcaat
catgtaaaat tgatagtcat gtaactttga ctatgataat atgcaactct ttttatttaa aacattttat ttctatagat
attgttagtc aaaatagcat ctcgaagaac gtgtcagagt caaaaatact tatattttgg gatggaggga gCAGTGAAAA
CTAAGAAAGT ATATATATAA GAGATGTCGT ATTATAGATG TCATATCATC TTGTTCTGTG ACCAGGACTT TTCTACTGTC
TAAATGATCA TTTATATGCT CACATCTCAG GAAGATATGT ACTATCCACG TTCATCCAAA CTGGATATGT TTTGGTCCTT
TCTCCACAAG TTTATTGAAC CAGTTTTGTT GCGCTGGCCT GGGAGAAAAC TGAGGGAGAA AGCTCTGGCC ACTTCCATGA
GGAATGTTCA CTATGAAGAT GAGTGCACTC GATACATCTG TTTCGGTGGT GTACCCAAGG TAAACTGACT ATGATTGTTT
GTTATTTTTT ACATAATAGA GGTGCTGTCT TCTTGCTTAG AACTTTCTTG ATGCTAATTG ACGCAGCTAC TTTTTTAGTG
ACCTTGCCAA AAAAAAATAC ATGAGTGGGT AGTAACACTC CATTTATTTT AGGAACAAGA AGTCCATCTT TAGTCTTTTA
TAATATGACA GTGCATATAC ACATAGCGTC CCTATCCATT TTCATGGGGC ATAAACAAGA AAGtactcca tccgttccaa
ataactattt tattttgtct tttctaaatT AATTAATAGT AATTTGGAAG GGAGGGAGTA CTATGGTTGA TGACTATATA
TATATGACTT ATGTGGACTG CACGTAGCGC GGGTGGCAGG AGCCAGTGGC TCGCTCGGTG CTAACCAGCG TTCAAGTCTC
AAGACTTGAC ACTCGTCCCT CGCCCGTGGG GAATTTTCCC CTCTTTCCCC GGGACTGTCT TTGGAAGGTC CCGGGTAGGT
AATAAGATAT ACACACGCGT ACACGTTCAG TGGGACTGCA CGTTTTCAAC GTGCACTGAG ACCTAGTGCC TACAATCTCT
TTCCTAGCGT GTGTTAGGGA CGTGCACGCT TGTGTGTGCG TGTGTCGTGG TGTGAGTGTG GTGTGTGTAA AGTGTGTGTC
CTAAGTTGTA CCCTTCTTAA AAAAAGATAT ATATGGCTTA TAGGAACAAT CTAATCTCAC GGAAGATTGT TTTGCGGTCT
GAGTTGGAAA GTGTTCTACT ATTAGCAACG ACcactagaa tatgttcggt catctgtaac gggtctaaag cctcatctct
atcggatagc gcctccgtca ctaagcaaag gtcactgatg tgagaaaata tctcaattag gcatccggcc atcacggatg
acacacatct caatcgggcc aacactatag cccatcacag atgactctca tctctaacgg acctaaacta tagcctgtca
cggatgactc ctatctcaat cgggcctaaa ctatagcccg tcacggataa ctctcatatc aattgggtct aaattatagc
ccgtcacgga tgagtataat aaaaaataaa taaattatgt ttttttggct agccTCAGCA CACATAACCG GGAAGAATTT
CTCGGTCGGT CACCCATCTC AAAATTGCTC TAACATAAAC ACGCTTGACC TTAGAGTTCT TTAGGATCAC CTTCCGGAGA
AGAAGTTGTA CGTTGATTCA CACACACAAC CATCAATATA TTTAATACAA TCACATTCAC ATAACATCCA TTTTGATCAC
ATATTTCACA TCCATTCACA TATTTCACCA GCAAAACCGA GTTAATTTGA TCAAATATAT ATTTAGCAAG TATGAGGAGG
AAAATCAGAC TTCTAGGcaa aaataaattt cgaattgaat tttataatac taaatgaact catatgaaaa aatcgtcaaa
aacaaagttg tagaactCat tgagatctac caattttgtt ttggtcattt ctccatccgg gtttgattga actatataaa
atttgaattt taaaatataa gaaatttaaa taatttttcg agcagtaaat gatttcaaat ggaaaaattg tcaacaacaa
agttgtataa ctcatcaaga tctataactt ttattttggt tattttctat ataacatttt ttgaacagtt tgaatttgaa
tttgaaaata tgataacttc aaataatatt ttcaaatacc aaatgatttc aaatagtaaa gtcatcaaca acaaagttgt
ataacttatc aagatttaca acttttattt tggtcatttc tctatataac atttattgaa caatttgaat ttgaatttga
aaatatgaca acttcaaaca acaatttcaa atactaaatg atttcaacta aaaaagtcat caacaacaaa gttgtataac
tcatcaATTT CAagcctgtc acggatgaca catatcagtg acggaccgta gtttaggcca gattgagata acattgcata
tctcaatcgg gcgctttttt ggcccgattg agattcttgt gacagtcact aattccaagc atattagagg ccgtcataga
tggaagattc tgtactagtg GACATTACTA TGTGGAAGAC AAATTGTGAT CATCAAAATG CTTGGTAGAA TAGCTTAATT
AGTGAGAAAA TATTGTAACG GCATCTTGTT ATTTATTTCA GCATATACAT TAGGAAAAAG TAGTATCCAT AAACCACCAC
TACTATTTGT AGGAGCGCCC CCATCTTTTT GCAAGGGCGG ACAAAAAGAT CTGTCACCCC TGTAAATATA TTTACCAAGG
GTGGACGTGG GAGGCAAGCC ACCCCTAAAA AGCAACTCCA TTTCCAAGGG CGGAACACGT ACACATAGGg gccgagtcta
gttccaaatt ttttcttcaa actttcaact tttctatcac cttaaaactt ttaacttttc catcacatcg ttccaatttc
gacaaaactt ccaattttaa cgtaaactaa acacaccAGG AGATACAGCT TCCAATCCAA GTAATTAACA AGCAATGAAA
GGTGAACCGC TTTAACTTCG ATCCGGTGCT GGAATTCACA CAGCACACGC TCCGAGAAAC CGATCAATTA ATTTTCTCTT
GATGAATGGG TTCAAATTCT TATCCCAATT GGGGTGTGTT TAgagcaact acaatagcag actattagcc agctgtaaac
atattttaat gagataaggg atgagagaga agagcagcgg gctacagatc tgtagccagc tgcagcgcgg gctccaagac
ataatgtgtg tatgacacgt gagaccatat attaatagta tagtaagcaa ctattgtata aattggttat tagattagct
atagatgaat tggagctaGT AGTGGGCTAT ACTATATTGA ACTtgttctt agttccaaag ttttttttca aacttccaac
ttttcccatc acatcaacct gtcatacaca cacaaacttt caatcacatc gttccaattt tcaaccaaac ttccaacttc
ggcgtgaact aaacacagcc TTGGTTAAAA TTAATACCGC TCCGTTAAAA AACTATTCTA ACCAGTTAAT ATTCAAGCTG
GCTAGCATAT AGGATATATG TGCCGGTAGG GAATAGCACC GGTTGTCGTT GGTACAACAA CAACGATGTA TGTTTAGTTC
ATTATTCGTA CAACAACGGT GGTACGTTTA GTTCATTATT CGTATCGGTT GTCGTTAGCA CCGGTGTGAA TGTACTAAAC
ACAACCGTGT ACTTTGGACC AATACGTATG AGCCGATACG AATGACGGTC TCTGCACTAG TGATATTTTA ACACCAAGAT
AAACAGATGC GTATGTACAG CGCATCTGTT CAAGCTCTCA TTATCTCTTC ACCCAAACCG AAGAACCCGT GCTTTGACCA
ACAAGGATAA TGTTTTAATA CATGCAGTGC AGTCAAGAAA AGACAGATGT GAGGTTCCAA TACCCATCTT ATAAAGGGGC
AAAGTGCCTC TGAACGAACT ATCCAAGATT GACCCTTTTG GACAATATGG TTGTTATCAG GGTCATTGTA TGCTGTTGTT
CATAACATCG CTCATTCCAA GGATTTTATA AATGAATGTC ATGCCTATTA TACAGTACCA TATTTAGAAT ATATGGTTCT
ATAGTTCAGT GGCATTAGAG AGAAACCAGG AAGGCCATGG AAGTACTGAC GTGGAGTAGT GGACATATAC TGATATAGGC
TTTAACACCA TATGCTACAG CTAGCTTCAT TACCTTGAGG TCGTGTCCTT CACACAACGG ATAGTATGAA CAAACATGTT
GAATAATTTT GCTAACTTCA AATCAGAGAG ATCCACTATC TGTCTATCCA TCTCTATTCT AATCACAACC TCTCAAGAAA
TTCCAAGGTT AGTTTGAGAA AATAATTGAC TGTTAATCCA ATGTGGGGCC AAGTAATAAT TAATGGTGAg tgttggaaat
tttttgtaac aagttgacaa gcatgatcgt agcacctaaa cgccttgcga tgatatggtg ttgccaacca ccctaatcta
gcaattgcta aatcaagatg ggtttcgata gattaaaccg gctagaggaa ccgatttaga gatcaaaatc agcctctagg
ccgatttaga tcgatatgag gataactacc cgtctcgtgg gtaaaacgga aggtttttag gacaaaccta caaagaggtg
ccgccctctc gcagcggcgg cggatgattt acggcgcaaa tcgataaaga tgtactaaaa ctagggtaaa gtagaaaaca
tggctaaaga taaaaagaaa aagcgattca agtatattgt gtattcaggg tattacaatg agctggcctt gtcccttaaa
tagggattgg tcttgccctc tacaggccct tctccacatt caactcggga tagaaaccaa aagaaaccca aaacatgcct
ttccgggcaa ggaaacccga gacccgatga aaacagactc ggactcggac cctgacggtc tgaccgacca catacctgtg
gtttagacac ggccctacta gccggtgaga ccgcccacat acctgtggtc tgaccagccc tgtgaaggaa acccggcagt
ttctaaactt tgccaatttt ctctatttcg tccataggtg ctaaatttgg gtgtaaacac atgcatccct gcctttttta
tgaacatcgt gaatctaaaa gcatagaaca tgttgtctta gggcgataat ccaattacca gccacaggac ttcctaagca
tctcgccaaa cgctagggaa gtatttcttc aagtatttcc catggattgt tttcttgaag tgcatccatc tctttcaaag
tcttcaaacg cttatcgatg acgtcttcaa aattgcctcc catcaatatc ttgtaatctt caaccgacaa gtcgtcttgc
ttgaaatacc gaagatagcc aagatttacc tcaattggca aaacggcttc ttgtccacag accaattcaa aagaagtgac
tttggtaaca ccatgtttaa atatcctatg agtccataat gcttccgaaa gcacctcatg ccacttcttt tggtgttctt
caatctcctt ttcgactaat ttcaacaatg ttttattact cgactcggct tgtccattag cctgagcgta gtaagaagaa
gaactcaaca acttaatatc ataagattcg gcaaaactct tcacctcctt ggacataaaa gaagctcttt gatcaaagtt
taaggaatat caaatctatg aacgatatgc ttcaaaacaa agtcaattac ctccgtgtaa gtaatattct tgagcggcac
ggcttcggcc cacttgatga agtaatccgt tgcgattagc acgaaccgct gcccctttga tgatgaagga taaatttgac
caatgaaatc caaagcccaa ccttggaacg accatggttt attgatagga ttcaacacag tggtaggcac taattgaaca
ttgccgatcc gttgacaaac ttcacatcct ctatattact tgaaacaatc atcaatcact ttcagccaat agaatcccac
tctcctaagc aaccaaatcc atcttacggg ccaattgatg agttccacaa atcccttcat gtacttctcc catagcaacc
ttagattgat cattatctaa tcacttcaaa agtactccat ctatttttcg acgatataat tctctatcaa gcaaagtgta
tttgaacgct tgtcaccgaa ttttccgatc aatcctgaga ctaggatctt tcaaatattc tattcaaagg gattctccag
ttttcttctg actcttcggc acaaatatcc gaattcacaa ttaattcagc ctttgaatca attataacgt gccccttagc
tttttgcccg ggatcagtta gactggccac gcaatgccgg tcggaccgcc ctatctgccc ggtcagacca gccatgcaat
gccggtcaga ccgcccctgg tctatgattt tgtcaatttc tcccaaagat ttaaaaaatc aagcaccggc ttttctagtt
tcaaaaagta atcctttctt catattatag ccagatgttt ggtgtatcaa attactagac caaaatttct tctttctaga
catatgaaaa attataacat ccaactaata tatctagatg aatactaatt caagtggctt ttgaaacaat aatcatcaag
gcatcaaaaa tgcttagccg cttgaagtat gatcaataat gaatcaccaa agtcatatgt gtcacatgca tagattccaa
taaactacaa atgtaagtaa tcgacttaag catgtatgca aaatattaac aatgccaatg ttcctaaaaa aaaccactct
agagcaaatc atcacattga ccattgacat tagccgaatt actaagcaaa attttcatgg tgcaataaat atgaaatcta
tatcttatat ggtgatccat aaaaacatac atgatttggc ttttaataaa tatcaaagaa ccatgagcca aatcatactt
caaacaaatt atatgccaat ttaccaattc cactacttag aactggcatt tgcaacatgt atgtataata tcaatttgat
aagcaaaaac acatgtgcta gatagcaagc aatgttctaa catggcatag gcatataata taatggtaaa cataataaac
acataccttg tcttagcatc caacaaacgg cggctcaaag atgtgatgtt gtacccatcg ttgttcatct cttttgattt
cttcatgagc atattaatgt cttgcccccc gagcaaaatc ggctttcttg attgcacgat ttcaaaggca agatgaatac
cgcactaata cccatagcat catatgaatg agacttatct ctaatgaccg atgattcttc tctcatcaaa ttggatttat
cactactttg ggaaatcacc aatctcttaa cttttatctc tttaggtctc cacgctcgct taggtgtcgt tcgaggctca
aaattgttac atattttgtt ctccacatct tcggcttctt tttctttttg acctatggct cgaagatgtt gtagcctcct
cttctgagag cgagataagc cagaaggtat ccacttcggc tgtggttgta ttccaagagc taaatgatga ttcttgattt
tttttcagtt gaagtggaag ttcttgtgtt gttcttaact ttcccactct tctccaatgc cccccggtca gaccagcctc
tgggcccggt tagaccggtt gcaagccgtc ggtcagacca gccagctgtc tcgatcagac caccactttt ggcagtcacg
gcgtcggctt cagtcttctt cgcttgtata gttttcaccg catctctagt aggtacttga acgtcttgag attcctcctt
gatagtgacg acctccggag ctttggcttc ttttctcacc cacaccttct tcacctgttt cacctttgat ccaccggacc
gactcttttg tgggaaacgg tcttgactag agttaaatga atgacttggt actgacctag atgattgctt ccattcttga
tgaaacggca tatatggttg aggcatccat ggcatataat acataaaagg ataaccatat agtgacattg gatatggata
ccatggcatc acaatcggag gtttgtatgg agttggtata gttgatggct ccgattgctt tggtgtttga ccaaatctct
tcctacgata tgatcttggt cttttcaaat cactagtctg attatcgaat tgttgaccag ctaatccttt cttgtactta
gccataagca tctcaaaagt gaggttcagc tttttggtct tttggaaact agatgactca tcctttacaa ctttatgatc
gtcggctttt gtattattga tcctagtctt aggccgaaga tccccaataa taacacattt cccttttgtg gattcggctt
gactaggccg aatcactact ttctcgttat ctaaatcaat aggactaata gggagaggat tactaacaat tctggtctta
gcaaaaggta taaccgaaat agtatcacaa gtgaccgatg aattatcaat cggattttgc tccatcaagc ttgcatcttt
aaaataatca tgaaactcat gctccatttg cgaccatgta gaaattgaat tgggagcaag taaactatac catatagatg
caaagtttga caaagaaaga gaaaacaatt ttaacttaag caaatcatta ctaccggtct taccagattg ttcaataaat
tggcagatat gctccattgt tgttctagca tcctcacctg tgaatttcgt gaagttgggc acctcaaatc cttgcgggta
tgggaccaaa tctatgcgtt caggatacgg cctttgatat gtatgcatag ctactttgga ttctatttca ctactatacc
gcaagacatt gtcatcacct tttccaacat ccacatgatt gatttgtgac tcgatcttag gtgacaatac tatttcactt
tcgcttgtga tacaatccga accatcattt agttcggcta tattttcaat ggcactattg tctaagctag caacacaatc
cgaaccaaca cttagttcgg ctatactcat tatggcatca ttgaccaaat tattaacaca atccgaacta tcgcttggtt
cggctataca tgatattgca ctatcatcta aactagcatt taagctattg ttatccactc ggctttcctg agccagagct
tcatgcaaca catgatcaac atcaagaaat atctggccat tcaatctctc tttaatataa tcaagcaatc catcatatgc
aatgtcggcc aaatctttgt cagttatttt caaactaaaa catcggcttt taatatctct aaacctttca atataatcag
caacagattc attgtgtttg tgcctaaccg atgttaaatc aaacaaccta agcccagttt taccaatgca aaaataatca
tgaaattttt gttctaattg agcccaagta tgaatagaat ttgccggtaa agaagtaaac catgtaaaag tagtaatgga
caaagataaa gaaaataagc acaatttata agtatcagaa ctactagcct caccacgttg cgttaaaaac tgacctacat
actcccatgt ggtcctacta tcctcaccac taaagttggt aaattcagga actctataac cacgagggta tgggatattg
tcataataat caggatacga cttttggtac tccctagcac gatccatcgc ttcaatccca aatttatccc taataatgat
actagttaac tcttccatat tctcaggcct atgctgattt ggtggtgggt ttggtgacct aaaaggttgt ggttgtggcg
caatataatt atattagcca tacctagtat cgggaggata tcccctagta ggatcattgt aaacattagg gatatgtggg
ggaacatagg gattaacagt agatacagga gaatcatgta ccggaatatg gtataaaagc acattatttg tcattggatc
aatcccctat accaggataa ttacgccgat ctgaccggtc tagggcccgt tctggctggc atccagaggt gcggtcagac
cggtttaggg tccggtctga ccgctgggag gaaacccggt ctgccggtct gaccagcggc gagcgcgcgg tctaaccggc
cgtctagccc ggtcggaccg gctgaatgcg cagctcctcc ctcgctggtt gtttgcatat ttgccccatc ggttttgggg
taaatttgat ctacatgggc ttaactagta ctggtagagg ctttatttta ggttggaaat cggctataaa agaaacgaat
ttatttctca aaaaatcagc aaaacgagat tcaatagatg catctaattt actatttaga gcagcaatgg atgaatctat
tgtagttgct atgtgttgtt ggataggaat tgatacctct tcagtactca ccatatcaaa actaggtttg atcaacggtt
caggcttgag aaccacacct tggtgggtcc taaagcacga tctcattagc gcctcctgcg tgatcgcttt gatgcactcc
tccgtaatct tgcgtgcttc cacatcaaga tcctccaatg agatcttgtt gatctcgttc ccgctcgtca tgattgatga
agaaactcct taattaattt cagccataca gctcataacc aaaatatttt gaccgaataa attaatatac ggtctctaaa
tttccttgat atgctactgt tcttagccaa ttttgtccaa aactagcttt tgttgatttc ctggacgtaa cagtgaattc
ggtactgtag caaaatatac aaaaattaac cgatctgaaa taagatcggc tgctctgttt cctattttct ttttggtaac
agtgtgctac aataaaaagg aaacaatatt cttgctgctt tttgtttctc agcaaccgtg tataacacgt actagcacga
ttaatcagac tgatcggctg ctgtgccgct gttaactggt tccttgcgtg ttgatgctcc tgcttcctgc cgactagatc
ggcgactgcc ctggtcaaac cggactgaat acgtcggtta gaccggtgca atatgaccgg ttagactggc tcggctatgt
cggttagaca ggcacagtga gcggtcaatt aattgacaga tagatttcgg ccgttgggcc gaaactcttg attggatgaa
acgatagaca attagattaa acgaaattca gccgtgatat ggctgattag atcgttcccc agcgaagtcg ccaaaaaatc
gtgttggcaa cttttttgat aagtcgacaa gtacgatcgc agcacctaag cgccttgcgg cgatatggag tcgccaacca
ccctaatcta gcaattgcta aatcaagatg ggttttgata gattaaaccg gctaacggaa ccgatttaga tatcaaaatc
agcctctagg ccgatttaga tcgatatgag gataactacc cgtctcgtgg gtaaaacgga aggttttcag gataaaccta
caaagaggtg ttgcactctc acatcggcgg tggacgattt acggcgcaaa tcgataaaga tggactaaaa ctagggtaaa
gtagaaaaca tggctaaaga taaaagaaaa agcgattcaa gtatattgtc tattcggagt attacaatga attagccttg
tcccttaaat agtgttaaca gtgaaatttg gtaagcccga agtcatcatc agctaagaat aagtatcggc tctagagtac
tggaatcagc cgatgggagt catcaaatca ccagcaaccg tatttcccgt ggagtcggat caactaaagg gaatttatcc
ataagagtcc gaattcaaga aggatgcggc atagcaagtt atctattaat taggcatagt ttagtttcct tttatcttta
ggaaagtgtg tttagtgtcc gataaggact ttatgttttt cttttatctt taggaaagtt tttttcttgt ccgacaagga
cttgtaccaa cccatgggta taaatatgta cacatggggt ctatgtgatc aatcaatcga tcaaaacaac tactctcgat
gcatcgccac cctctttact gaggttttta cttatcttcc ggcgaaattt gggcacctga cgcggggcta catcggttca
gttcgatctc cggcgaaggg gtaagtccta cgttccgttg ggccctggtg aatctgtcat ctacgttggc gtcgttcaag
gctgcatcag tacattggac ctcttggatt gctccggttt ggatgatatg tttgcctact tatttatcat atgtctctgt
taatctagtg ttaccatatc aatttagctc tatcgattgc ttttcgcttt agggtttcta ccggtatcgg ctaaatcgtg
ttgctagatt agattagctt aggcatctac caccctgaaa attagtcaag ggcttgattg tctagatatt gtttttcttt
ttatacttag tgctgcatca gttaagtttg atctactaag tcgtgcttag aaccataatc cctagcctac ttgttgactg
ccaataaggg tttcatcggg gtttcagccg atgaattatc tggacgttgc atcggcttat aaggattgta tatataagtt
ggatttagct gatcgcaaca aaggtttcac tgtttaatat aatcttgtgg attttatggc attggatctc cagccgatgt
attatttaac cttcggatca gtgcttattc taccatgtta ttattagccg attggtttct attggattat attattgtta
ttttattaca tcatcatcag ccgaatacct ttatatcatc atctacattg gacatatagt cggttgctta agccctatcg
ctatcggctg gtatcggcat cggctattat cggctatcgg ctggaactac tccatcggct tgtcagccga tcggctgttt
gatctactgt ttacatatct tgtcagttac aggatcaaac tgactagcac gcccgcttct catcttttga acctgcactg
gagctaagca gatctcccag gccggtgtgt tcgatttttt cgtcaacaaa tagggattgg tcttgccctc tacaggccct
tctccacatc caactcggga tagaaatcaa aataaaccca aaacatgcct tcccgagcaa agaaacccga aatccgaaga
aaacagactc agacacggac cctgatggtc tgaccggaca tatacctgcg gtcaaacctg ccctactagt tggtcagacc
gcctacttac ctgtggtctg accggccctg tgaaggaaac ccgacacttt ctaaactttg ataattttcc cttatttcgc
ccataggtgc taaatttggg tgtaaacaGT TAGGAATAAA GATTTGAAGT TAGCATCTCT ATTCTAATCA CTACCCACGA
GTCCATATCC CTCACGTTTT ATTCAATGAT ATTTTTTCCT GAGATCTATC TAAAATGTAC TCTAAGAAAT CAGAGTCATC
CCTCCAAGAA ATCCGAAGCC CTCAACTGTA ATATCCCCTG CCCTATGTAT CACTGTAGTA GTAGTTGATG GCCTATGTGG
CCCAACTGTA GTAGTGATAT GGTGGGGTTG GTACAATGTT CTATGTTTAG GGGGTGAGGG GCCAGCAAAT ACTCGTCATT
GCTCGAAATG TAAAACTTTG GTGTTAACCG TTTTACATGA ACTGATCCTT TACGATTTAT TACTTTGTGT ACTTCATAGT
TATTGAACTT CTGTCAGAAA TTAGTTTATG CCCTAGTGTG GTTACATTTG TTTCCCATCA GCTTGTCACT AATAGCTGAA
AAATAAAATA ACTAAGTAAA TTATACACAG GCATTAAATA TCCTTGCTTG CTGGATTGAA GATCCAAGCT CAGAGGCATT
CAAATGCCAT ATTGCACGCG TATATGATTA TTTATGGATC GCTGAAGACG GCATGAAGAT GCAGGTAACT TTTGGTCGTT
CTTTGATTGT TTTTAAAagc aagtataata atgagtttta agcctactat aaacttagat ggagaagaga gatagtaaaa
aacaaggatg ttggctctca tgcaagagct agcttatcac aagctccaag ataaatacat taaatgtata agtgagagat
agagagagga gaaaaaaatt atagctaacc ttatagctaa tctattatat atgttggttt taagataggc taacagtagg
aagtgagctc tactattatc tttgctctaa gagcacccgc aatggtaaag taaggtgcta tctataaaac atgtacatct
caacaataga ctagattaat agtaaaccac tttaatggta tgtctacatg ggtatctata gctctctaat ccattacctc
gtttttctct atagactatc tctaagttag tagatagttt tgttctctct cttcatttaa tctctttcaa gtaagaaaat
atgctgacat gaatctcttt gtagagagac tatagataac cattgtgggt gcccTAAGGC TCACTTCCTG CTATTTGCTT
CACAACATTC CATACAATGG CTACTGCATT AACAAACTAA TTAATCAACA TTTACACTTC AACGGTGTTT ACTAATTGTT
TGTTCATGCT CAATAAAGCC ATTTttagta taccaaatac tgaatatatc ataactgttg agattgatgt agtttaatag
atgaaaagtc cttcctaccc tctcaataaa tgtcctttgt tgggacagaa ctcaacaagt gtgtgtattg cctctatatt
caatgtgcct gaatgtgagc agtgtttaca tatatatata caagggtata caaaaggaaa tgtcttcaat gcccctagcc
ctatgatgaa tctcgagtgg ctggccagta ggccagcctt taatctatta gtaatatcat aggtggcagg agggaggtgt
ccattaagga ggcagtaccg attcccgagg tagctcgcta ttgctcgcct aaaagcatgc tccgggtaat aacgtgcacc
gtctggacgt catcaacagt gtcagggtta gttagagcat gtaatgcgca tttactccaa cccactagcg cctggtcctt
gaatttgggc cgttagggcg tattgtgcct tggttccttc cgagccgcac tattagctct ggaaacctcc gaagctccga
agtccctggc cgcctccgga gccccttgag cgtgctccga aggctcgcca ggctccggag ctcgagatgc cctccgtggc
tccaggagcc tcggatgctc cggcttcctt gatcactctc ggaatccctt gggcgacctc cgaagccttg ccaggctctg
gagcccttag tggccaccgg agccaTTACT ATTCTCCGAG ACCCTTAGTA GTTTCCGGAG CGGCGGCTTC AGCCAGGGGA
CCCAAAGTGG CATTCACCCT CGGTTATCTC CCTGGGGAGG ATGGCTCCTC GAAGCCCTGC AGGCCTTCCG GAGGCTGACC
ATTTAATCCG GAGCCATTCC CCCAACATCC TTTAATATAC TACTATTCAG GCAAGGTGAA GGTAAATAGA AAAATTACAT
TCAAGGACTC CACTGCTACC TCGGTGGGTA GTCAGTATTA CGAGTTTTAA TTTGGGCTAC GCAGCCATTT GCAGTTGCTC
AGAAGTCTCC ATTAGCATTC AAATTTAAAA ACTACTATTC ATAACATAAA TGTGTGGTGG AGGCGTGGAG CAGTAGCGCC
CCTGATTTCA CTGCAGGGTT ACGACTTCTC AGGCCCTAGT GGGGTTACAA CGTTAACTAT TTAGTGCAGA TTTACGATGG
CAGCCAGGTG TGGGACGCAG GTTTGACAGT TGAGGCCCTT GTGGCTACTG ACCTTGTCAA AGAGCTTGGA CCAACTCTTA
AACGAGCGCA TTCCTTCCTT AAGAATTCGC AGGTATATAT AATCATGCCA CTAGACCTCA GTAATTTGTC CATAAAATGT
CAATTTCAAT CAGCATTACT TACTGGTTAT GTATAATAAG GAAGCTATTT TCTATATGAA AGTTGCTTGA CAATTGCCCC
CGAGATTTCA ACCGCTGGTA TCGCCATATA TCCAAAGGTG GATGGACATT TACAACAGCT GATGATGGCT GGCAAGTTTC
AGATTGCACG GCGACAGCAC TGAAGGTAAA CGATTAAATT TTCCTTATTA CCAATATAGA TGTTTTTTCA TCTAATTTAA
TTTCTTTCCC TTTGTCTACC GAAAACGTTA TGTGCTCATG CATATACAAA AAATAAAGTA GTAATTCTTT CAGAAGCATA
ACAGTTTTCC TGGACACCAC TACTACAAAA ACTCCTTTTA CAGTTGCTGC AGAACTATAT ATTACCGCAG TAGGATAAAG
AACTTGCTGT CAAATAAATT AGTATAATGT TTGAATATAT ATATATATAT ATATATATAT ATATATATAT ATATATATAT
ATATATATAT AGGGGCATGC ATGAATGAAA GTTATCTTTT TCATTGTCCA ACCAAATCAA GTTGAACTAA GGTACTATgg
ttgtgtttag ttcctgaaat tgaggagaag tttagagaaa attggtagtt tggaaaaaaa aagttggaag ttttgtgtag
gaaagttttg aatgtgatgt gatgtgatgg aaagttggga gttgggggaa gtttggatgt AATGTGGTGT GAACTATAGA
TTATTTTCTG GAATACATAG AATAGCTGCA AATCGTATCA TTATGGAAGG ATAGAAAAAG AACCTCCAGA ACATGCCCAA
ATCAAAAGAT GCATAATCAC AACCCACCAA AGTCAAATTA GACGGGACCC TTAGTGGACG AACAGTCACC CCAGCGAACG
GTGGGTCCCA CCTGCCCTTA CTCATTCCTT ATCTTCTTTT TTTTTCTTCC TTTCCACCAT CTTCTTCCCC CGACCACACG
TCTGCACCAG CAGCAGCATG TACCGCCCGC GGCCAGTGGC GAAATCGCCA CCGCGCCcag gggtggatct acagtattat
gaccggtgtc aggcgacact gacgactttc ggcaaaatct atagcaaatt tgcttatcca tatgttataa caccataatt
taaatataat taggattcta tgacaccgat agacacgtta tgacaccaat gaatcgattt tctggatccg ccactgACCG
CGCCTCCCCC CGCCTCCCAC CCCTGCGGCG TCACAGCATC CTCCCGTGCT ATTGCTGACC CCTGCCACTG GGGTCCTCCC
AAATCCGGTC GGCAGCGCCA CCGCCGGCCG CAACCCGCCA GGCCACCACC ACGGCCGGCG ACCATCCCTC TAATCCTGCC
TGCCATGGAA CATTCGAAAC CCCAATCCCT AACTCAAATC CCTCCCCCAC ACCCCCGCCC CCGCTGCTGG CCTCCGCCAC
CACCCGCTTC TCCCACCTCT CGCCATGGCC GCTTTTCACC ACCCTTTTGT TTCTCTTGAC GAAGAGTTGA AGACAACGGG
TGCGGATGGA TCAGAGCAGA ATCAATCAGC ACCTTACGCG TGTCCTTTCA TTACTTACGG TAGCAACACA CGTTCATCAA
ATAATATAAG GATTTCGCAA ATCAGAACAG AAACACCACT GTCAATGAAA GGACCACCAT AGCACATGAC AACACATGGA
GGGGTTCCTG GATCAGTATA TATATATTAA GACCAGACTC TTTAGATACT AAATAATTGA TTGTAAGAAA CTGGTTGTAA
CTTTTAAGGG GTGGACTTTC TAGCCATAGA AAATGTGAAT ATGAATATTA GAGACTAGCT GCTATCTAGC TAGTTAACCT
CAGATCATGG TTGTCTCCTT CAAATAATTA ATGAGTTGTC CAGGACATTA AAATGGCCAA ATTGGATTTG AGTAAGGGTT
GAAGAAAGTT TTAATTATGG AATAGGTTCA AGTTCAAACC AGCCAAGCAa gggtgtgttt agttccacgt caaaattgga
agtttgattg aaattgtaac gatgtcacgg aaaagttgaa agtttgtgtg tgtagaaaag ttcgatgtga tgtttttggg
ttcaaagttt gcatctaaac acggTGTAAA ATATAACAAA ATTCAAGAAA GTCCCATCAG CATCATTAAT TCTTGGGTGC
AAGTTCATTA TTAGTGATGT TAAATTGGAG TAAATAACTA GCCCAGTGCA ATAGTAATTT GTTTATGCTT ATTGTTGGTT
CCAAATATTA AACGTTTAGC TAATTTTCCC AACTTGAAAC ACATGTTGGA ATTACAACAA TAGGGTGTGC GAGTGCCTGC
AGAAATACTG AGGGGGAGTG GGAGCAAATG GTCATGGAAC ATATAGGGCC TCCACTTTTT GCCCTCCACA TTTTTATATT
ATCTTTGTGT CATCAAGTAA CACACCAGAT ACACATTTAG TACAGTCAGT TAAAAAACTT GACTCCCTTG AAGTAATATT
ACAGTTGGCC ATGCACTGTA CAACATGTTT ATCAATATCA GTTCGTAGAT CCTCACATGG TTCAAGAACT CAAGATAATG
AACCAACTGT ACTGTCAACA TCTTTTTTAA CCAACTGTTG CATGTTGTTT TTGTTTCTTA ATAAATTTCT TTGGTTTTTA
AGAGTATCTA TGCTGTTACA ATTTACGTAC AGGCATGTCT ATTGTTATCA AGGATATCTC CTGAAATCGT TGGTGAACCA
CTGGAAATTG ATGCACAATA CGATGCTGTT AATTGTCTGA TGTCTTTGAT GGTAAACATT TTTCAATCTT CCGTCTACTA
TTCTACACGA GTTGTTGTAG TCAATGATCA GAATTTTGTA CAATATTCAA CTTTGAAGAG CCTTGTGTCT GATATGTTTG
TGTTAATTAC CATTTACAGA ATGATAATGG TGGCTTTTCA GCATTTGAAC TCGTAAGGTC TAATACATGG CTGGAGGTGA
GGGGTTGATT TCTTTCAGGA TGCTCCTTTG TCCTTTCCCA TGTTATATAT ACACGTAAAT CCCAATGTAC CAAGTTATTT
TTTCTGTTGC TAGCAAAAGG GGGAAGATAG CGCGCCTAAA TAAGTGGACT TTGCTAATGA ATAATAATGA TACCAATGCT
ATATGATAGC GGTACTAATC TGTCCGGGAA AAAAAATACA ATTGCACTCT TAACAGGACA AGAGAGAAGA TCTCTAACCG
TGGTAAATTT ATAGAAATAA AGTGTTGCAG TTAAAAAAAA AGGTGGATGG AGAAAATCAA GTACAACGGA TCAGAACTTC
AAATTCACCC CTGTTTTGTA CAATCTCAAG TAAATGGTGT CATAGAATGC AAACTTAAAC AGGATAACTG TTAACATAGT
TAAATGCACA TATGCATATA TGTAAATTAA ATGCATATCT GTTTTTCTCC CTAATTATAT GGTCGATGAA AAAGCACAGC
TACATTCATC ACTGTGACTA AATTTGGCTA ATACTGACAT GTTTTGTTGG AGTTCAGCAT ATTAATCCTA CAGAGGCATT
TGGGCGTGTA ATGATTGAAT ATCCGTAAGA TGAGATAACC CATTGAATTT CATTTCTTAT ATACTTCCCT TTTTTATCGT
ATATAAGACA ATCCCAAACA ATATGCATCT GAATTGACAG GTATGTCGAA TGTACATCAT CATCAATTCA GTGTCTAGCA
TTATTCAAAA AACTTCACCC AGGGCACCGC AAGGAAGAGG TGGAAAATTG TATCAGCAAA GGTGCTAATT TCATTGAGAG
TTCTCAGAGA AGCGATGGTT CATGGTATGT ATTAGGACAG GATGCATACA TAACTACAAA TATGTGCGAC CGATGATTTT
ATAAAAATCC CTACTCAATT CTGATTAAGC TGTGTTCTTA CAGGTATGGT TCTTGGGGGA TTTGTTTCAC CTATGCCACA
TGGTTTGCAG TGACAGGATT AGTTTCTGCA GGCAGGACAC TTGGGAATAG CGCTACAGTT AGAAAGGCAT GTGACTTTCT
CTTGTCAAAA CAGCTTCCTT CGGGTGGCTG GGGCGAGAGC TATTTGTCAT GTCATGACGA GGTAACTTTC GCATCAGCCT
TATCAGTTTG GACAATTTCG TTTATACCCC TATTTTGATG TTTAATATTG ATTTTATCCT TACTTTTTAG GGTTTTCGTT
TTTGTTCCCA CTTTTTTTGA ACCGAACAAT CTTTTTGCTC TTGTTTTAGA TAGAGAAGTT AATGGTGTTA AATACTTGGC
AAAAGGATAT TTATACCCTT TCCTATCTCT ATTTACTAAT TGTGTTTTGC CTCCATTCTA TGCATGACTT TGGAAATTTA
TTTAAGTGAA TATGTTTTAA ATTAAATGAC CCACATTGAG TAACATAACA ATTTGGACAG ATATCTGAAT TTGATGAAAT
TTTGATAAAA TTTCAGCAAC ATTTTAACAG AAATTGAACA GACTTTTGAC AAAATCTGAA CAACATTTTA CACAGTCGTA
TTAAGTCATT TAACAGCCTC ACAAGTACTA TCACAAATTT CAACTCAATG TCATTGACTT GTCCTACAAA TCACATCACA
GCAACAAAAA TACACATGta ctccctccgt ctcataatag gtgacgtttt taacttttta tttacaacgt tcgaccattc
gttttatttg aaaaattagt gcaaatataa aaaagataaa tcatatgtaa agtacttttg ataataaagc aattgacaaa
caaaataaat aataattcta aaatttttga ataagacgaa tgatcaaata ttgataaaTA AAAACTAACT AAAAAGATAA
AAAGATAAGT AATATAAGTA ATATGGGACG GAGGTAGTTA GCTAATTGTT GCTTGGATGG ACGGCGCCGT GCGTTTGAAC
GAACCCGCCC GCCGGTGTCG CGTTGCTGCT GATCCTCAGT TAATGGCGTG GAGCAGCGGC CCCGTGCTGT TGTCGAGGAG
GCAGGTGGAC GTACGGGTAC GCCGCCTCCA ACGCCATATG CCCCGCGAct aatcattaga taaatttttt aagtctaatt
aatctataat tagataatgt ttactgtagc atcacatata ctaatcataa attaattagg ctcaatagat acgtctcgcg
aattagtcca aaattatgga tgagttttat taatagtcca catttaatat ttataattaa tgttcaaaca tccaatatga
tatggattta aaagttttag tctcatctta aacatggTCG TAGTCCAACG ACATCGACGC CCACCAGTTG GTGCAGTCGA
CGATCAAGCT GCTGCGACGA CTGGTTGTTC GTCCAGATGG ACGTACGTGA TGCCCTCCAC CGCCGCCGCC TGCCCGATGC
CCAATCGCAG CCGCCTGCGC CGCTCGGATT GATTTCAGGA CTGACCCCGT GTGTGAGAGG AGAGAAGAAG AGACTCTAGG
TAGGGTAGAT ATTTCCCATG GGTACAAACC TAAATCACAA ATTCGAAAAA TGTTTATTTA CTGCTATAAA TCTGGTCCCA
CTAACTTCTG TCTAAATCAC GGGTGGTAAA CGTCTCTTTC GGTTAAAAAA AGTAGGGGCA AAAACGAAAA CCTAAAAAAT
AGTGTTAAAA TCAAATTGAA CATTAGAGTA GGTGAAGAAA CAAAATTATC CCTATCAGTT TTGTTTGAAG CTGGTATTTA
GGGTGGCTAT TGTTGCATGC TGCTATGTCA GGATTTAGTG TTTCTACGTA TTTCCTACAA GGAGTCAACA CGACGGATGC
TATTGGATTA TTTATTTTCG CAAGAAATTT TGAAAAAAAA AACAGCTTGA AGATTATGGA TTTTGGAATC CGAGATTCAG
CAACATGGTT CTAAAAGCTA AAATAAATAG GCCCTAAATC AAGCCTTCAA CCACGTAGAG CTGACCAACC ATCTTCTGAT
TTTCATTCAA TCAGGTTTAC ACAAATCTTA AAGGCAACCG ACCTCACGGT ACGCACACTG CGTGGGCCAT GATTGCACTA
ATTGATGCAG GGCAGGTATG TTTTTTTTTT TTATGTATAA CTTTTGGCCT GTGGATTTTG GGACAATAAT TCAAGGTGCT
GTTATAGGCT GAAAGAGATC CAGTGCCTCT GCATCGAGCA GCCAAGGCTT TGCTCAACTT GCAATTAGAG GATGGAGAAT
TTCCACAGCA AGTAAGTAAC AGCTGATCGA CTGCTAATTA CAACAGCAGT GTTAATTTAA TTATAAACTA TAATGGTAAA
TAAGGTTCAT GCACTACTAC AGAAAGCTTT TGATCGCTGA TTCGTAACCA CCACCACCAC CCCCCCCCCC CCCCCCCCCC
CAAAACTGCA CCACTGGTTT TGGCAACCAC TAGATGAATA GTGACAGTGA TAGCTGCTCG AACCCACAAC GACGATAGCC
CTTAAGAATG AAAAAGAACA GTGTAAAAAA TACttctccc ttcatatttt aatgtatgac gtcgttgact tttcgtccaa
cgtttgacta ttcgtcttat ttaaaatatt tatgaaatta ttatttattt tattgtgacc tgattcatca tcaaatattc
tttaagaatg acataaataa tttcatattt ctataaaatt tttgaataaa acggatggtc atacgttgat gaaaaagtca
acggcgtcat atattaaaat acggagggag taCATAATTA ATGGTGGTAT ACACTTTAAT TTCTCCCAAG AGACTACCTA
ATGTAGCACT GGATCAATCT TCCGGTAGGT ATGACAGATT CGATTTTGGT GGATAACTTG GCGTAATGAT ATCCAGGCTT
TTAACTCGAA CCGTTGAAGA ACCCAACTCC ATTGATCTTG CCAGGAATTA ATGCTTTCCA TTGCAAGCGA ATCAAAGGAC
ACAAACAAGA AAGTGAAAGA ACGTGATCTG AAATTGCAGA TGCATATGAg agcaagtata atagtaggct ataagccggc
taaatgctga gatggaggag agaagagtgg agagaaagga aaagcgggct gtaaacttac agccggcttg gacacaagaa
ccaaaaaaat ctatgagaga gacaagtgga ccctgtatta attataaaga gttaactatt atatggatag gctgagagaa
agctacaaag aaccttatag ccaacaggtc ggctgtatta ttagccttgc tcTGAAGCGA ATCCGAGTAT GAAGTTTGAG
CTCTTAACAT Gaaaggacta atcgccattg tcgagaagaa caagaacaag gggctttgga taacaacaaa tggacatgtc
atcacagtta taatgaacga tatgtctaga taaaacacat gaaactaaga gacggctatt gagctttatg cactatagga
tgacctaggg ttggggggat tattgcccga cacgatatga ggcccgatgc cccgatacag cccaaaactg gccggtggcg
tacgtagcac cttgtcgtga ctacacggaa tgatccacaa ggcttcttag tctagagata actagaGAAT GCCCCGCGCG
TTGCTGTCGG ACTTGGTTAA CATCAATTTG TTAGATAGGA GGTACAATCT CAAGAAGAAA CGGAAGAAAC AAATGGCTTT
CTTGGAGAAA TTCTTTTTAG CAACCCTATT CAAATTTTGT AGATAATTTA GGTAGCACAT TTAAAGCATA AGCTACAAAG
AAGCAAAATG GTCTGATCGT AAGTTAACAA ATTGTAATGT TAACTGAATG GGCGTTCAGT CATAAAGCTC TTTTATACGG
ATTGATGGGC CGGATACATG TAGATGTGTG TAGAGATGGG CCAATATGTT TATGTGGGCT ATATTTGGCA CTGAGGAGAT
AAAGAGACTC ACCCGGTGCC TGACAGGTTG GGCTCTATGC TGCGGTCCAT CCAATGGTTG AGAACCAATA TAATGCATTC
ATTCAACGGT TCATAATTGA TGATGACGTG AAAATATGAG GTCTGAGCTT TTAGCATTAA CTTTATAGAA AGAAGGGATA
GAAGAACCGA AAGAAATCAT TCAACATTAT TAGCTTAtta ccaacgcatc aaagtatgcc taactcgctt caatgtcgta
tgaaggagat attatcattt ccatgtaggg tggtcagcta gttccgaacc gaacgctagc taaagactga gtttgtgaca
aattgtaact tggtgcgaga atggctcgtg tgtatccacc atggtgatgt cctaatcaCT ACCAGACGAT TTCGCACATG
ATGTATCCTC GGGGATTCAA ACACTCGTGC GACCAGAGCA TACTATGCCA TACAGTCACT TGTGATTAGT GAAGGGACAT
TTTTATAGTA ACTAATTCTC TTAATCTCGC TATATTAAAT ATTTGGATAT AAAAAATGAA CCCAACTGAA AAGTTCTAAA
CAATTAAGGT TCATATCTCG TAAAGCACTA CAATATCCTT CTGAGCTCAT TTAAAAAATT CAAAATTTTG AATTTTAGAA
TATCAAAAAT AGTAATAAAA TATTTCAGCA CCTAAACTta taaattattt catcacctaa accattttaa ctgaaaaagg
ttgtcaacta caaattttta ggcctaatcg agttctaaaa ctttttatag aacatatctc tatctgaagt cattaacaaa
atcaaaaatt taaatttaga tgaaaacttg tgagctacaa attttagatg tcctcaaaat ctataatttt aatacacaag
ttGTCTTTGT CTGACTTCAT TTTTAAAATT ATAAATTTCG CTCCCGGATC TCTGTGTCAT TGTACTACTC ACACATCACC
GCTAGGTCAA GACTGAAACT GGTGGTTCAA AGTGGTGATA AAATAGCact ccctccgttc cataatataa gagattttga
ctttttgctt gcactgtttg accattcgtc ttattaaaaa aaaattagaa ttattattta ttttatttgt gacttacttt
attatccaaa gtactttaag cacaactttt cattttttta tatttgcaca aattttttga ataagacgag tggtcaaaca
gtacaagcaa aaagttaaaa tcccttatat tatgggacgg agggagtaCA AGTTATTGAT GTCAGTTTGT AGATGAAACC
AGCAGTTATA TATCCCCATG CACCGCAATT TTAAGGAGTA AACAAAATAA TCTTGTAGTA GCAATGATGT TATTATGTTT
GCCAACTATA CCATGACTAC TATAAAAAAT AAAAGATAGC AGATTCACAC TAGTCTCAAA ATCGTTATTG ATCTCAGCAT
GTTTAAACAT AATACACCTG AACCTATTTT GTATATATAT CTGTGCACAT TTTTTGCATT GTATAATATG GTCAGATACA
ATAGATCAAT CGTTGAGTTG AAATGAGAGA ACATGTTTTA TTGTAAATAT ACATAAACTT TTATTACTAT ATGCAAACAG
TTAATTAAAT TTTTATTTAT GACTGTCAAC AACAGGAAAT TGTTGGAGTC TTTCTCCAAA CTGCCATGAT CAGTTATTCC
CAGTACAGGA ACATCTTCCC TATAATGGCT CTCACAGGGT ATCGCCGCCG AGTACTGCTT GCAGGCAACA TATAGGAGCA
TGATTTTAAG TTATGCCAGC TCTTGGCATG TTGGTTTGCC AATAAAGTTA CATTTCACCT CCCCTAGCAG CAGTACTCTC
TACTGTTCTA GCGTTTGTAT TTTGTATTTT CTAAGAAAAA AATGTTTTAC CGCATTTACT TAGTTCCCTT TGTTTGTAAT
AAAACATGGA ACATACTGCT TCCTTGTAGT TACACGTGCG TTCTAATAAG AAACATTATT ATATCT