Os11t0207900-00

Locus

Os11g0207900

Description

Similar to Flavin-binding monooxygenase-like family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YUCCA14

CGSNL Gene Name

YUCCA-LIKE GENE 14

Oryzabase Gene Symbol Synonym(s)

OsYUCCA14, OsYUC14

Oryzabase Gene Name Synonym(s)

Transcript Evidence

tplb0009m23 (Wheat FLcDNA)

Protein Evidence

Q2R929 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: flavin-containing monooxygenase activity (GO:0004499)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Molecular Function: NADP binding (GO:0050661)

Functional domain (InterPro)

Pyridine nucleotide-disulphide oxidoreductase, class-II (IPR000103)

FAD-dependent pyridine nucleotide-disulphide oxidoreductase (IPR013027)

Flavin monooxygenase-like (IPR020946)

Expression Databases

TENOR (Os11t0207900-00)

Others

Oryzabase (9112)

Transcript

1204 bp

>Os11t0207900-00 Similar to Flavin-binding monooxygenase-like family protein.
TCTGCTCACTAGTTACATCCTACTACGTGATTACCTAGCAATGAATGCTATGGAGGACGT
GGTTGTTCtcatcgttggtgcggggccagcaggcctagcaacggcggcgtgccttgcaca
gcggcatgtgccatacatcattgtcgagcgtgagtccagcaccgcatcgttgtggcgcca
ccgtgcctacgaccgcctcaagctacacctcgccaaggagttctgcgagctgccacacat
ggcgtatccggcgggcacgccgacgtacgttcctagggatatgtttgtggagtacctaga
tagctatgctaaccagtttgggatacggccgaggtaccacactgctgttgagtcagcaat
acatgataaaggtaagaaccaatgggtcgtgctagtacgagacatggacactagtgttgt
ggcaaggcttgctacacagttccttgttgtggccgctggcgagaacagtgcggcaaacat
tccaccaattcctggcctcagtaggttcgagggagaagccattcactcgtcagcttacaa
gtccgggagagcctataccgggaagagtgtgcttgtggtaggtgccgggaattctggcat
ggagatcgcttatgaccttgccacgcatggagcccacacctccatagttgttcgtagccc
gGTACACATAATGACCAAAGAACTAATATGGTATGGGATGACAATGGTGCAAAATTTAGG
GCTAAATGTGACAGCAGTGGACTCTCTTCTTGTAATGGCGGCAAATTTCTATTTCGGAGA
CTTGTCAAAACATGGTATTATGAGGCCTAAAATGGGTCCTCTCTTACTCAAGTCACAAAC
AGGCCGGTCTGCCGTTATTGATGTTGGCACTGCAAGATTAATCAAAGGAGGAGTTATCAA
AGTGTTCCAAGGAATATCAAAGATAAATACAAACAGTGTTGAATTTCATGGTGGGAGGCA
AAATTCATTTGACGCCATTGTATTTGCGACAGGTTACAAAAGCACAGTTAATGCATGGCT
AAAGAATGGTGAAAGCATGTTTAAAGACGATGGTTTCCCTAAAAATTATTTTCCAAATCA
TTGGAGAGGTGAAAATGGGTTGTATTGTGCTGGGTTTGCTAGGAGAGGATTGGCCGGTAT
TGCCATGGATGCGAAAAATATTGCAAATGACATCGTGGCCGCCATGGATAAAATGTCATG
TTAA

CDS

1164 bp

>Os11t0207900-00 Similar to Flavin-binding monooxygenase-like family protein.
ATGAATGCTATGGAGGACGTGGTTGTTCtcatcgttggtgcggggccagcaggcctagca
acggcggcgtgccttgcacagcggcatgtgccatacatcattgtcgagcgtgagtccagc
accgcatcgttgtggcgccaccgtgcctacgaccgcctcaagctacacctcgccaaggag
ttctgcgagctgccacacatggcgtatccggcgggcacgccgacgtacgttcctagggat
atgtttgtggagtacctagatagctatgctaaccagtttgggatacggccgaggtaccac
actgctgttgagtcagcaatacatgataaaggtaagaaccaatgggtcgtgctagtacga
gacatggacactagtgttgtggcaaggcttgctacacagttccttgttgtggccgctggc
gagaacagtgcggcaaacattccaccaattcctggcctcagtaggttcgagggagaagcc
attcactcgtcagcttacaagtccgggagagcctataccgggaagagtgtgcttgtggta
ggtgccgggaattctggcatggagatcgcttatgaccttgccacgcatggagcccacacc
tccatagttgttcgtagcccgGTACACATAATGACCAAAGAACTAATATGGTATGGGATG
ACAATGGTGCAAAATTTAGGGCTAAATGTGACAGCAGTGGACTCTCTTCTTGTAATGGCG
GCAAATTTCTATTTCGGAGACTTGTCAAAACATGGTATTATGAGGCCTAAAATGGGTCCT
CTCTTACTCAAGTCACAAACAGGCCGGTCTGCCGTTATTGATGTTGGCACTGCAAGATTA
ATCAAAGGAGGAGTTATCAAAGTGTTCCAAGGAATATCAAAGATAAATACAAACAGTGTT
GAATTTCATGGTGGGAGGCAAAATTCATTTGACGCCATTGTATTTGCGACAGGTTACAAA
AGCACAGTTAATGCATGGCTAAAGAATGGTGAAAGCATGTTTAAAGACGATGGTTTCCCT
AAAAATTATTTTCCAAATCATTGGAGAGGTGAAAATGGGTTGTATTGTGCTGGGTTTGCT
AGGAGAGGATTGGCCGGTATTGCCATGGATGCGAAAAATATTGCAAATGACATCGTGGCC
GCCATGGATAAAATGTCATGTTAA

Protein

388 aa

>Os11t0207900-00 Similar to Flavin-binding monooxygenase-like family protein.
MNAMEDVVVLIVGAGPAGLATAACLAQRHVPYIIVERESSTASLWRHRAYDRLKLHLAKE
FCELPHMAYPAGTPTYVPRDMFVEYLDSYANQFGIRPRYHTAVESAIHDKGKNQWVVLVR
DMDTSVVARLATQFLVVAAGENSAANIPPIPGLSRFEGEAIHSSAYKSGRAYTGKSVLVV
GAGNSGMEIAYDLATHGAHTSIVVRSPVHIMTKELIWYGMTMVQNLGLNVTAVDSLLVMA
ANFYFGDLSKHGIMRPKMGPLLLKSQTGRSAVIDVGTARLIKGGVIKVFQGISKINTNSV
EFHGGRQNSFDAIVFATGYKSTVNAWLKNGESMFKDDGFPKNYFPNHWRGENGLYCAGFA
RRGLAGIAMDAKNIANDIVAAMDKMSC*

5'UTR

chr11:5514544..5514583 (+ strand) : 40 bp

CDS

chr11:5514584..5515204 (+ strand) : 621 bp

chr11:5515504..5515743 (+ strand) : 240 bp

chr11:5515857..5515979 (+ strand) : 123 bp

chr11:5516121..5516300 (+ strand) : 180 bp

FASTA

>Os11t0207900-00 class=Sequence position=chr11:5514544..5516300 (+ strand)
TCTGCTCACT AGTTACATCC TACTACGTGA TTACCTAGCA ATGAATGCTA TGGAGGACGT GGTTGTTCtc atcgttggtg
cggggccagc aggcctagca acggcggcgt gccttgcaca gcggcatgtg ccatacatca ttgtcgagcg tgagtccagc
accgcatcgt tgtggcgcca ccgtgcctac gaccgcctca agctacacct cgccaaggag ttctgcgagc tgccacacat
ggcgtatccg gcgggcacgc cgacgtacgt tcctagggat atgtttgtgg agtacctaga tagctatgct aaccagtttg
ggatacggcc gaggtaccac actgctgttg agtcagcaat acatgataaa ggtaagaacc aatgggtcgt gctagtacga
gacatggaca ctagtgttgt ggcaaggctt gctacacagt tccttgttgt ggccgctggc gagaacagtg cggcaaacat
tccaccaatt cctggcctca gtaggttcga gggagaagcc attcactcgt cagcttacaa gtccgggaga gcctataccg
ggaagagtgt gcttgtggta ggtgccggga attctggcat ggagatcgct tatgaccttg ccacgcatgg agcccacacc
tccatagttg ttcgtagccc ggtaTGTACA ACATATTTGT TTATCTTGCA TTACACTCCA TTATGTGTTC AAACCtatat
atgtttcttg tttattgttc aagcaatgat ggaatacatt aattccatta ttgattcgta attagaattt attcatgtag
tattttatct ttggttctac atttgcatgt agatactata aatgAGGAAT GTGATTATAT CTAAATGTTT ATCCGAAATT
GTCATGTTGT ATCTTTCTAT AGATAAAAAC TTTTTCCTAA TATAATGGTC ATCTAATGGT TTTGTGGCAC CTAAATACAG
GTACACATAA TGACCAAAGA ACTAATATGG TATGGGATGA CAATGGTGCA AAATTTAGGG CTAAATGTGA CAGCAGTGGA
CTCTCTTCTT GTAATGGCGG CAAATTTCTA TTTCGGAGAC TTGTCAAAAC ATGGTATTAT GAGGCCTAAA ATGGGTCCTC
TCTTACTCAA GTCACAAACA GGCCGGTCTG CCGTTATTGA TGTTGGCACT GCAAGATTAA TCAAAGGAGG AGTTATCAAA
GTAATCATGC ATCTACACTC TTTAGATACA AAATTAAGTT GGTAGTGCTT GTGAAGTTTC TAGCCTCAAT TGATGTTCAG
ACTTTACACC ATTTCTTTTC ATATCTCTAT TAGGTGTTCC AAGGAATATC AAAGATAAAT ACAAACAGTG TTGAATTTCA
TGGTGGGAGG CAAAATTCAT TTGACGCCAT TGTATTTGCG ACAGGTTACA AAAGCACAGT TAATGCATGG CTAAAGGTAC
AAAGAATATG GATATTGCTT TAAACTCTTC TCTCTTCTTT TTTAATTCTA TTTGTTTACA CAATAATATA TTTTGTTGCA
TTATGCATGA TTTTGTTTCA TTATTACAAA AGGATAATCC TTTTTTATCG GTTGCAGAAT GGTGAAAGCA TGTTTAAAGA
CGATGGTTTC CCTAAAAATT ATTTTCCAAA TCATTGGAGA GGTGAAAATG GGTTGTATTG TGCTGGGTTT GCTAGGAGAG
GATTGGCCGG TATTGCCATG GATGCGAAAA ATATTGCAAA TGACATCGTG GCCGCCATGG ATAAAATGTC ATGTTAA

Locus: Os11g0207900

Loading...

Locus: Os11g0207900

Loading...