Os11t0210300-01

Locus

Os11g0210300

Description

Alcohol dehydrogenase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ADH1

CGSNL Gene Name

ALCOHOL DEHYDROGENASE 1

Oryzabase Gene Symbol Synonym(s)

Adh1, Adh1/2, adh1/adh2, OsADH1

Oryzabase Gene Name Synonym(s)

Alcohol dehydrogenase1, Alcohol dehydrogenase 1, Alcohol dehydrogenase-1, reduced adh activity, Alcohol dehydrogenase I

Transcript Evidence

AK069330 (DDBJ, Best hit)

Protein Evidence

Q760C7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

J023014M06 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0210300-01)

RiceXPro (AK069330)

Others

Oryzabase (927)

KEGG (Os11t0210300-01 (EC:1.1.1.1, EC:1.1.1.284))

Transcript

1867 bp

>Os11t0210300-01 Alcohol dehydrogenase 1.
GCCGGCCGTCGCGCATCCGACGGCCACTCACCATCGGCGTCGGGGGAGGCGAAAACAGCG
GCTGCAATTCCGCTTCCAGGTGGAGGGGGAGGAGGCCCGGTTTGTGTGCCACGCCGCCCC
ACTCCGTCCGTGGTTTGCTACCCAAGAAGACAAGAAGAAGGAAGTGGCGAAACCTCACCC
TCCATCCTCCATCCTCTCCTTTCTTCCTTCGAGGAGGAGGAGCTATATATAGACGGGGAT
GGTTCATCTAGCCTCCTCACCGGTTTTGATTTGATCTGTGTGATTTGAGTGAGTGAGTGA
GATTCTTTGGAGGAGGGATTTTGGTTTGGTTTGGTTTGGTGGTTTGTGCGGGATTTTGTG
GGGAGGAGAGTAATGGCGACCGCAGGGAAGGTGATCAAGTGCAAAGCGGCGGTGGCATGG
GAGGCCGCGAAGCCGCTGGTGATCGAGGAGGTGGAGGTGGCGCCGCCGCAGGCCATGGAG
GTGCGCGTCAAGATCCTCTTCACCTCGCTCTGCCACACCGACGTCTACTTCTGGGAGGCC
AAGGGACAGACTCCCGTGTTCCCTCGGATCTTCGGCCATGAAGCTGGAGGTATTGTGGAG
AGTGTTGGAGAGGGTGTGACTGATCTTGCCCCTGGTGACCATGTTCTCCCTGTGTTCACT
GGGGAGTGCAAGGAGTGTGCCCACTGCAAGTCAGCAGAGAGCAACATGTGTGATCTGCTC
AGGATCAACACTGACAGGGGTGTGATGATTGGTGATGGCAAATCACGCTTTTCCATCAAC
GGGAAGCCCATTTACCATTTCGTCGGGACTTCGACCTTCAGCGAGTACACTGTCATGCAT
GTTGGTTGCGTTGCGAAGATCAACCCGGCAGCTCCACTTGATAAAGTTTGCGTTCTTAGC
TGTGGTATTTCTACTGGTCTTGGTGCTACAATCAATGTGGCAAAGCCACCAAAGGGTTCG
ACGGTGGCGATATTTGGTCTAGGAGCTGTAGGCCTTGCTGCCGCAGAAGGTGCAAGGATT
GCAGGAGCGTCAAGGATCATTGGCATTGACCTGAACGCCAACAGATTTGAAGAAGCTAGG
AAATTTGGTTGCACTGAATTTGTGAACCCAAAGGACCATGACAAGCCAGTTCAGCAGGTA
CTTGCTGAGATGACCAATGGCGGAGTTGACCGCAGCGTTGAATGCACTGGCAACATCAAC
GCCATGATCCAAGCATTTGAATGTGTTCATGATGGCTGGGGTGTTGCTGTTTTGGTCGGC
GTGCCACACAAGGACGCCGAGTTCAAGACCCACCCGATGAACTTCCTGAACGAGAGGACT
CTCAAGGGAACCTTCTTCGGCAACTACAAGCCACGCACCGATCTGCCCAACGTCGTCGAG
CTCTACATGAAGAAGGAGCTGGAGGTGGAGAAGTTCATCACACACAGCGTGCCGTTCTCG
GAGATCAACACGGCGTTCGACCTGATGCACAAGGGCGAGGGCATCCGCTGCATCATCCGC
ATGGAGAACTGAGGTTTTTCAGGGGATTATGGTGTTGGGTAATAAGATTGGGCAGCTTGA
GCAGCCTGCCTTGGGTGAATGATGATATACGGTTCTTCTGTGTATCCTGGGCAAATTTCT
GGCTTTGTCAATCAGTAATAGTACGGTATGAATTCCAGTGTCTGTAGCTGCAAAGAGTTT
GTTAAGAATCAGTGATCTTTTGGCGTAATATTATCATATATTTATACGAGTTTCAGTTCG
TCACCCTCTTCACTTTTCAGAACTTTTTTAAGTCTTATGACTTCAGAGCCACCAAACGTG
CTGTTTTTGAATTCCATGGTGGCTTGAATTTGGTACATGTTCATGTAAATGTGGGATATT
TGTCATC

CDS

1140 bp

>Os11t0210300-01 Alcohol dehydrogenase 1.
ATGGCGACCGCAGGGAAGGTGATCAAGTGCAAAGCGGCGGTGGCATGGGAGGCCGCGAAG
CCGCTGGTGATCGAGGAGGTGGAGGTGGCGCCGCCGCAGGCCATGGAGGTGCGCGTCAAG
ATCCTCTTCACCTCGCTCTGCCACACCGACGTCTACTTCTGGGAGGCCAAGGGACAGACT
CCCGTGTTCCCTCGGATCTTCGGCCATGAAGCTGGAGGTATTGTGGAGAGTGTTGGAGAG
GGTGTGACTGATCTTGCCCCTGGTGACCATGTTCTCCCTGTGTTCACTGGGGAGTGCAAG
GAGTGTGCCCACTGCAAGTCAGCAGAGAGCAACATGTGTGATCTGCTCAGGATCAACACT
GACAGGGGTGTGATGATTGGTGATGGCAAATCACGCTTTTCCATCAACGGGAAGCCCATT
TACCATTTCGTCGGGACTTCGACCTTCAGCGAGTACACTGTCATGCATGTTGGTTGCGTT
GCGAAGATCAACCCGGCAGCTCCACTTGATAAAGTTTGCGTTCTTAGCTGTGGTATTTCT
ACTGGTCTTGGTGCTACAATCAATGTGGCAAAGCCACCAAAGGGTTCGACGGTGGCGATA
TTTGGTCTAGGAGCTGTAGGCCTTGCTGCCGCAGAAGGTGCAAGGATTGCAGGAGCGTCA
AGGATCATTGGCATTGACCTGAACGCCAACAGATTTGAAGAAGCTAGGAAATTTGGTTGC
ACTGAATTTGTGAACCCAAAGGACCATGACAAGCCAGTTCAGCAGGTACTTGCTGAGATG
ACCAATGGCGGAGTTGACCGCAGCGTTGAATGCACTGGCAACATCAACGCCATGATCCAA
GCATTTGAATGTGTTCATGATGGCTGGGGTGTTGCTGTTTTGGTCGGCGTGCCACACAAG
GACGCCGAGTTCAAGACCCACCCGATGAACTTCCTGAACGAGAGGACTCTCAAGGGAACC
TTCTTCGGCAACTACAAGCCACGCACCGATCTGCCCAACGTCGTCGAGCTCTACATGAAG
AAGGAGCTGGAGGTGGAGAAGTTCATCACACACAGCGTGCCGTTCTCGGAGATCAACACG
GCGTTCGACCTGATGCACAAGGGCGAGGGCATCCGCTGCATCATCCGCATGGAGAACTGA

Protein

380 aa

>Os11t0210300-01 Alcohol dehydrogenase 1.
MATAGKVIKCKAAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT
PVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKECAHCKSAESNMCDLLRINT
DRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYTVMHVGCVAKINPAAPLDKVCVLSCGIS
TGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGIDLNANRFEEARKFGC
TEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHK
DAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFITHSVPFSEINT
AFDLMHKGEGIRCIIRMEN*

5'UTR

chr11:5715917..5716288 (- strand) : 372 bp

CDS

chr11:5715883..5715916 (- strand) : 34 bp

chr11:5715487..5715623 (- strand) : 137 bp

chr11:5715343..5715389 (- strand) : 47 bp

chr11:5714188..5714513 (- strand) : 326 bp

chr11:5714020..5714102 (- strand) : 83 bp

chr11:5713865..5713940 (- strand) : 76 bp

chr11:5713722..5713783 (- strand) : 62 bp

chr11:5713546..5713641 (- strand) : 96 bp

chr11:5713302..5713463 (- strand) : 162 bp

chr11:5713026..5713142 (- strand) : 117 bp

3'UTR

chr11:5712671..5713025 (- strand) : 355 bp

FASTA

>Os11t0210300-01 class=Sequence position=chr11:5712671..5716288 (- strand)
GCCGGCCGTC GCGCATCCGA CGGCCACTCA CCATCGGCGT CGGGGGAGGC GAAAACAGCG GCTGCAATTC CGCTTCCAGG
TGGAGGGGGA GGAGGCCCGG TTTGTGTGCC ACGCCGCCCC ACTCCGTCCG TGGTTTGCTA CCCAAGAAGA CAAGAAGAAG
GAAGTGGCGA AACCTCACCC TCCATCCTCC ATCCTCTCCT TTCTTCCTTC GAGGAGGAGG AGCTATATAT AGACGGGGAT
GGTTCATCTA GCCTCCTCAC CGGTTTTGAT TTGATCTGTG TGATTTGAGT GAGTGAGTGA GATTCTTTGG AGGAGGGATT
TTGGTTTGGT TTGGTTTGGT GGTTTGTGCG GGATTTTGTG GGGAGGAGAG TAATGGCGAC CGCAGGGAAG GTGATCAAGT
GCAAAGGTCA GTGCTTTTCC TCCCCTCCCT GTTTCTTCTT GGTTCGATTT TGCTTTGGAT TGGGCGAACT TTTAGGCATT
TTATTACTGG AGCGGCGCTG TAGATGAAAT TCTTGGATTG TGTTCTTTTT AGAGTTTTCT TGGGTGAACA TTACCGATCT
TGCAGAAGCT GTGGAGAAAA GCATATCTTT TTTTTTAGTG AAAAATGTCA TTCAGGATTA TGTTTTTTTG GTGGATTGGT
GGGTGATTTT GCTGGATCTG TGCAGCGGCG GTGGCATGGG AGGCCGCGAA GCCGCTGGTG ATCGAGGAGG TGGAGGTGGC
GCCGCCGCAG GCCATGGAGG TGCGCGTCAA GATCCTCTTC ACCTCGCTCT GCCACACCGA CGTCTACTTC TGGGAGGCCA
AGGTATCTAC TCACCTCCTC TTCTTCAGTT CCTATCCATC CATAGCTGCT CCAATGTGTG GTTGACTTGC GCCTCTTGTG
TGGCTTCTGA ATCTCTTAGG GACAGACTCC CGTGTTCCCT CGGATCTTCG GCCATGAAGC TGGAGGGTAT GTGCTTTTAT
GCATCTTCTT CCTTGATTTT GTTTCTTGTT AATACTTGGT TGCTCTGATG CATGCTTTTG TTGCTGATGT GTGATGTGGC
ATGCTGTTAG TTAATTGATT TGTTGTTACT ACCTGGTTAC TCCACTGTTG TGGTTGCTAG TGTGGCCTGT TGTTAATTAA
TTGATTCTTT GTTAGTACTA CTTGGTTACT CTGCTGCTCT GGTTGCTGGT GTGTTGTGTT GTTAATTAAT TGGCTCGTTG
TTACTTCTTG GTTTACTCTA CTGCTCTGGT TGCTGATGTG GCATGTTGTT AAGTACTTAA AACTATGCTT TGTGGTTGAA
TCTTCCTCTA ATTGCAGTTT AGGGGGGGGG TTCATTGTTT ATTGGCTTGG CATTAGTAGA ACATTTGGCT GAGGTAATCT
GGACAACATG GGAAAGAATC ATATGGGCAC ATGCTGTTGC CTGTGTCAAA CATTATAAAT GTGTGCTTTT TTTGTGGGTC
TTCAGTTGGA TCTTGATAGA TTTATCAATT TATAACTTAT TACAAGGAAG AAACTTTTTC TTTCAGTTAG TAGTTGGTAG
TTTATTTTTG AAGTTGGCAG ATTTATTTGT GATAGGCGTT GATTGACCCT TTAGAAGACT TCTCTTCAAT AAGTTTGTAT
TTTCCAGTTG ACAAAGGGCA TATAAATTAG GCATTGCTTG ACCTTTATGC TACCTAACAT ATTCATGGTA CCCTTTCTAT
TTTCTGAAAT ACAGCGTGGA TTATTTTTTT TAACACTTCC ATTGAGTAAA AGATTCCTAT TGTTCATATC TGCTGAAATT
TATTCATTTC TGCAGTATTG TGGAGAGTGT TGGAGAGGGT GTGACTGATC TTGCCCCTGG TGACCATGTT CTCCCTGTGT
TCACTGGGGA GTGCAAGGAG TGTGCCCACT GCAAGTCAGC AGAGAGCAAC ATGTGTGATC TGCTCAGGAT CAACACTGAC
AGGGGTGTGA TGATTGGTGA TGGCAAATCA CGCTTTTCCA TCAACGGGAA GCCCATTTAC CATTTCGTCG GGACTTCGAC
CTTCAGCGAG TACACTGTCA TGCATGTTGG TTGCGTTGCG AAGATCAACC CGGCAGCTCC ACTTGATAAA GTTTGCGTTC
TTAGCTGTGG TATTTCTACT GGTAAGCAGA ATTTTTTTTG TTTCTTGCAT TCTTCTTACT TGATAGAATG TAAGTTGAGA
TGCTGAGTCG CAATTTCCTT TTGTAGGTCT TGGTGCTACA ATCAATGTGG CAAAGCCACC AAAGGGTTCG ACGGTGGCGA
TATTTGGTCT AGGAGCTGTA GGCCTTGCTG TGAGTGTCTG AACTCACCTT GAATGTTCTC AATTACAATG AGAGATCCAT
CTAATTACTC TACATATTGT CTGATTAGGC CGCAGAAGGT GCAAGGATTG CAGGAGCGTC AAGGATCATT GGCATTGACC
TGAACGCCAA CAGATTTGAA GAAGGTAAAA TCCTCTTGAT TTACCAGATC ATCAGTTTGT TTGATGGTCT TTTAAAGTCA
TCTTATATAT TTTGTATATC TTCAGCTAGG AAATTTGGTT GCACTGAATT TGTGAACCCA AAGGACCATG ACAAGCCAGT
TCAGCAGGTA TGTATGTTCC CTTACATCAG GAAAAGGAAA ATCTGTATCA CTTGATTGTA CTGATACAGT GTGTTATGGT
AATTTAGGTA CTTGCTGAGA TGACCAATGG CGGAGTTGAC CGCAGCGTTG AATGCACTGG CAACATCAAC GCCATGATCC
AAGCATTTGA ATGTGTTCAT GATGTAAGAT CTGAAAACAG CATATTGTCC ACTTAATACA GTTAATTCGA CAAGATGCTA
AATATATTAT ATGTTCTGAA TCCAGGGCTG GGGTGTTGCT GTTTTGGTCG GCGTGCCACA CAAGGACGCC GAGTTCAAGA
CCCACCCGAT GAACTTCCTG AACGAGAGGA CTCTCAAGGG AACCTTCTTC GGCAACTACA AGCCACGCAC CGATCTGCCC
AACGTCGTCG AGCTCTACAT GAAGAAGGTG AATACAAATC GCGAATCCTT CCTTTCGCTT TATCCAACTA TTACAAACTA
AGAGTAGTCG CAAAATCTTC AAATGTTCAT CGACCTCAAT CAAGAACTTC TGAAAGTTGG GTGTGTCCAT GCTCTTATAT
GCATACCTCC GCTGTTGTGA ATTCAGGAGC TGGAGGTGGA GAAGTTCATC ACACACAGCG TGCCGTTCTC GGAGATCAAC
ACGGCGTTCG ACCTGATGCA CAAGGGCGAG GGCATCCGCT GCATCATCCG CATGGAGAAC TGAGGTTTTT CAGGGGATTA
TGGTGTTGGG TAATAAGATT GGGCAGCTTG AGCAGCCTGC CTTGGGTGAA TGATGATATA CGGTTCTTCT GTGTATCCTG
GGCAAATTTC TGGCTTTGTC AATCAGTAAT AGTACGGTAT GAATTCCAGT GTCTGTAGCT GCAAAGAGTT TGTTAAGAAT
CAGTGATCTT TTGGCGTAAT ATTATCATAT ATTTATACGA GTTTCAGTTC GTCACCCTCT TCACTTTTCA GAACTTTTTT
AAGTCTTATG ACTTCAGAGC CACCAAACGT GCTGTTTTTG AATTCCATGG TGGCTTGAAT TTGGTACATG TTCATGTAAA
TGTGGGATAT TTGTCATC

Locus: Os11g0210300

Loading...

Locus: Os11g0210300

Loading...