Os11t0210300-02

Locus

Os11g0210300

Description

Similar to Alcohol dehydrogenase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ADH1

CGSNL Gene Name

ALCOHOL DEHYDROGENASE 1

Oryzabase Gene Symbol Synonym(s)

Adh1, Adh1/2, adh1/adh2, OsADH1

Oryzabase Gene Name Synonym(s)

Alcohol dehydrogenase1, Alcohol dehydrogenase 1, Alcohol dehydrogenase-1, reduced adh activity, Alcohol dehydrogenase I

Transcript Evidence

AK061267 (DDBJ, Best hit)

Protein Evidence

Q760C7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

GroES-like (IPR011032)

Alcohol dehydrogenase GroES-like (IPR013154)

Full-length cDNA

006-212-C12 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0210300-02)

RiceXPro (AK061267)

Others

Oryzabase (927)

KEGG (Os11t0210300-02 (EC:1.1.1.1, EC:1.1.1.284))

Transcript

1408 bp

>Os11t0210300-02 Similar to Alcohol dehydrogenase 1.
ACCGGTTTTGATTTGATCTGTGTGATTTGAGTGAGTGAGTGAGATTCTTTGGAGGAGGGA
TTTTGGTTTGGTTTGGTTTGGTGGTTTGTGCGGGATTTTGTGGGGAGGAGAGTAATGGCG
ACCGCAGGGAAGGTGATCAAGTGCAAAGCGGCGGTGGCATGGGAGGCCGCGAAGCCGCTG
GTGATCGAGGAGGTGGAGGTGGCGCCGCCGCAGGCCATGGAGGTGCGCGTCAAGATCCTC
TTCACCTCGCTCTGCCACACCGACGTCTACTTCTGGGAGGCCAAGGGACAGACTCCCGTG
TTCCCTCGGATCTTCGGCCATGAAGCTGGAGGTATTGTGGAGAGTGTTGGAGAGGTGTGC
CCACTGCAAGTCAGCAGAGAGCAACATGTGTGATCTGCTCAGGATCAACACTGACAGGGG
TGTGATGATTGGTGATGGCAAATCACGCTTTTCCATCAACGGGAAGCCCATTTACCATTT
CGTCGGGACTTCGACCTTCAGCGAGTACACTGTCATGCATGTTGGTTGCGTTGCGAAGAT
CAACCCGGCAGCTCCACTTGATAAAGTTTGCGTTCTTAGCTGTGGTATTTCTACTGGTCT
TGGTGCTACAATCAATGTGGCAAAGCCACCAAAGGGTTCGACGGTGGCGATATTTGGTCT
AGGAGCTGTAGGCCTTGCTGCCGCAGAAGGTGCAAGGATTGCAGGAGCGTCAAGGATCAT
TGGCATTGACCTGAACGCCAACAGATTTGAAGAAGCTAGGAAATTTGGTTGCACTGAATT
TGTGAACCCAAAGGACCATGACAAGCCAGTTCAGCAGGTACTTGCTGAGATGACCAATGG
CGGAGTTGACCGCAGCGTTGAATGCACTGGCAACATCAACGCCATGATCCAAGCATTTGA
ATGTGTTCATGATGGCTGGGGTGTTGCTGTTTTGGTCGGCGTGCCACACAAGGACGCCGA
GTTCAAGACCCACCCGATGAACTTCCTGAACGAGAGGACTCTCAAGGGAACCTTCTTCGG
CAACTACAAGCCACGCACCGATCTGCCCAACGTCGTCGAGCTCTACATGAAGAAGGAGCT
GGAGGTGGAGAAGTTCATCACACACAGCGTGCCGTTCTCGGAGATCAACACGGCGTTCGA
CCTGATGCACAAGGGCGAGGGCATCCGCTGCATCATCCGCATGGAGAACTGAGGTTTTTC
AGGGGATTATGGTGTTGGGTAATAAGATTGGGCAGCTTGAGCAGCCTGCCTTGGGTGAAT
GATGATATACGGTTCTTCTGTGTATCCTGGGCAAATTTCTGGCTTTGTCAATCAGTAATA
GTACGGTATGAATTCCAGTGTCTGTAGCTGCAAAGAGTTTGTTAAGAATCAGTGATCTTT
TGGCGTAATATTATCATATATTTATACG

CDS

279 bp

>Os11t0210300-02 Similar to Alcohol dehydrogenase 1.
ATGGCGACCGCAGGGAAGGTGATCAAGTGCAAAGCGGCGGTGGCATGGGAGGCCGCGAAG
CCGCTGGTGATCGAGGAGGTGGAGGTGGCGCCGCCGCAGGCCATGGAGGTGCGCGTCAAG
ATCCTCTTCACCTCGCTCTGCCACACCGACGTCTACTTCTGGGAGGCCAAGGGACAGACT
CCCGTGTTCCCTCGGATCTTCGGCCATGAAGCTGGAGGTATTGTGGAGAGTGTTGGAGAG
GTGTGCCCACTGCAAGTCAGCAGAGAGCAACATGTGTGA

Protein

93 aa

>Os11t0210300-02 Similar to Alcohol dehydrogenase 1.
MATAGKVIKCKAAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFTSLCHTDVYFWEAKGQT
PVFPRIFGHEAGGIVESVGEVCPLQVSREQHV*

5'UTR

chr11:5715917..5716030 (- strand) : 114 bp

CDS

chr11:5715883..5715916 (- strand) : 34 bp

chr11:5715487..5715623 (- strand) : 137 bp

chr11:5715343..5715389 (- strand) : 47 bp

chr11:5714491..5714513 (- strand) : 23 bp

chr11:5714391..5714428 (- strand) : 38 bp

3'UTR

chr11:5714188..5714390 (- strand) : 203 bp

chr11:5714020..5714102 (- strand) : 83 bp

chr11:5713865..5713940 (- strand) : 76 bp

chr11:5713722..5713783 (- strand) : 62 bp

chr11:5713546..5713641 (- strand) : 96 bp

chr11:5713302..5713463 (- strand) : 162 bp

chr11:5712810..5713142 (- strand) : 333 bp

FASTA

>Os11t0210300-02 class=Sequence position=chr11:5712810..5716030 (- strand)
ACCGGTTTTG ATTTGATCTG TGTGATTTGA GTGAGTGAGT GAGATTCTTT GGAGGAGGGA TTTTGGTTTG GTTTGGTTTG
GTGGTTTGTG CGGGATTTTG TGGGGAGGAG AGTAATGGCG ACCGCAGGGA AGGTGATCAA GTGCAAAGGT CAGTGCTTTT
CCTCCCCTCC CTGTTTCTTC TTGGTTCGAT TTTGCTTTGG ATTGGGCGAA CTTTTAGGCA TTTTATTACT GGAGCGGCGC
TGTAGATGAA ATTCTTGGAT TGTGTTCTTT TTAGAGTTTT CTTGGGTGAA CATTACCGAT CTTGCAGAAG CTGTGGAGAA
AAGCATATCT TTTTTTTTAG TGAAAAATGT CATTCAGGAT TATGTTTTTT TGGTGGATTG GTGGGTGATT TTGCTGGATC
TGTGCAGCGG CGGTGGCATG GGAGGCCGCG AAGCCGCTGG TGATCGAGGA GGTGGAGGTG GCGCCGCCGC AGGCCATGGA
GGTGCGCGTC AAGATCCTCT TCACCTCGCT CTGCCACACC GACGTCTACT TCTGGGAGGC CAAGGTATCT ACTCACCTCC
TCTTCTTCAG TTCCTATCCA TCCATAGCTG CTCCAATGTG TGGTTGACTT GCGCCTCTTG TGTGGCTTCT GAATCTCTTA
GGGACAGACT CCCGTGTTCC CTCGGATCTT CGGCCATGAA GCTGGAGGGT ATGTGCTTTT ATGCATCTTC TTCCTTGATT
TTGTTTCTTG TTAATACTTG GTTGCTCTGA TGCATGCTTT TGTTGCTGAT GTGTGATGTG GCATGCTGTT AGTTAATTGA
TTTGTTGTTA CTACCTGGTT ACTCCACTGT TGTGGTTGCT AGTGTGGCCT GTTGTTAATT AATTGATTCT TTGTTAGTAC
TACTTGGTTA CTCTGCTGCT CTGGTTGCTG GTGTGTTGTG TTGTTAATTA ATTGGCTCGT TGTTACTTCT TGGTTTACTC
TACTGCTCTG GTTGCTGATG TGGCATGTTG TTAAGTACTT AAAACTATGC TTTGTGGTTG AATCTTCCTC TAATTGCAGT
TTAGGGGGGG GGTTCATTGT TTATTGGCTT GGCATTAGTA GAACATTTGG CTGAGGTAAT CTGGACAACA TGGGAAAGAA
TCATATGGGC ACATGCTGTT GCCTGTGTCA AACATTATAA ATGTGTGCTT TTTTTGTGGG TCTTCAGTTG GATCTTGATA
GATTTATCAA TTTATAACTT ATTACAAGGA AGAAACTTTT TCTTTCAGTT AGTAGTTGGT AGTTTATTTT TGAAGTTGGC
AGATTTATTT GTGATAGGCG TTGATTGACC CTTTAGAAGA CTTCTCTTCA ATAAGTTTGT ATTTTCCAGT TGACAAAGGG
CATATAAATT AGGCATTGCT TGACCTTTAT GCTACCTAAC ATATTCATGG TACCCTTTCT ATTTTCTGAA ATACAGCGTG
GATTATTTTT TTTAACACTT CCATTGAGTA AAAGATTCCT ATTGTTCATA TCTGCTGAAA TTTATTCATT TCTGCAGTAT
TGTGGAGAGT GTTGGAGAGG GTGTGACTGA TCTTGCCCCT GGTGACCATG TTCTCCCTGT GTTCACTGGG GAGTGCAAGG
AGTGTGCCCA CTGCAAGTCA GCAGAGAGCA ACATGTGTGA TCTGCTCAGG ATCAACACTG ACAGGGGTGT GATGATTGGT
GATGGCAAAT CACGCTTTTC CATCAACGGG AAGCCCATTT ACCATTTCGT CGGGACTTCG ACCTTCAGCG AGTACACTGT
CATGCATGTT GGTTGCGTTG CGAAGATCAA CCCGGCAGCT CCACTTGATA AAGTTTGCGT TCTTAGCTGT GGTATTTCTA
CTGGTAAGCA GAATTTTTTT TGTTTCTTGC ATTCTTCTTA CTTGATAGAA TGTAAGTTGA GATGCTGAGT CGCAATTTCC
TTTTGTAGGT CTTGGTGCTA CAATCAATGT GGCAAAGCCA CCAAAGGGTT CGACGGTGGC GATATTTGGT CTAGGAGCTG
TAGGCCTTGC TGTGAGTGTC TGAACTCACC TTGAATGTTC TCAATTACAA TGAGAGATCC ATCTAATTAC TCTACATATT
GTCTGATTAG GCCGCAGAAG GTGCAAGGAT TGCAGGAGCG TCAAGGATCA TTGGCATTGA CCTGAACGCC AACAGATTTG
AAGAAGGTAA AATCCTCTTG ATTTACCAGA TCATCAGTTT GTTTGATGGT CTTTTAAAGT CATCTTATAT ATTTTGTATA
TCTTCAGCTA GGAAATTTGG TTGCACTGAA TTTGTGAACC CAAAGGACCA TGACAAGCCA GTTCAGCAGG TATGTATGTT
CCCTTACATC AGGAAAAGGA AAATCTGTAT CACTTGATTG TACTGATACA GTGTGTTATG GTAATTTAGG TACTTGCTGA
GATGACCAAT GGCGGAGTTG ACCGCAGCGT TGAATGCACT GGCAACATCA ACGCCATGAT CCAAGCATTT GAATGTGTTC
ATGATGTAAG ATCTGAAAAC AGCATATTGT CCACTTAATA CAGTTAATTC GACAAGATGC TAAATATATT ATATGTTCTG
AATCCAGGGC TGGGGTGTTG CTGTTTTGGT CGGCGTGCCA CACAAGGACG CCGAGTTCAA GACCCACCCG ATGAACTTCC
TGAACGAGAG GACTCTCAAG GGAACCTTCT TCGGCAACTA CAAGCCACGC ACCGATCTGC CCAACGTCGT CGAGCTCTAC
ATGAAGAAGG TGAATACAAA TCGCGAATCC TTCCTTTCGC TTTATCCAAC TATTACAAAC TAAGAGTAGT CGCAAAATCT
TCAAATGTTC ATCGACCTCA ATCAAGAACT TCTGAAAGTT GGGTGTGTCC ATGCTCTTAT ATGCATACCT CCGCTGTTGT
GAATTCAGGA GCTGGAGGTG GAGAAGTTCA TCACACACAG CGTGCCGTTC TCGGAGATCA ACACGGCGTT CGACCTGATG
CACAAGGGCG AGGGCATCCG CTGCATCATC CGCATGGAGA ACTGAGGTTT TTCAGGGGAT TATGGTGTTG GGTAATAAGA
TTGGGCAGCT TGAGCAGCCT GCCTTGGGTG AATGATGATA TACGGTTCTT CTGTGTATCC TGGGCAAATT TCTGGCTTTG
TCAATCAGTA ATAGTACGGT ATGAATTCCA GTGTCTGTAG CTGCAAAGAG TTTGTTAAGA ATCAGTGATC TTTTGGCGTA
ATATTATCAT ATATTTATAC G

Locus: Os11g0210300

Loading...

Locus: Os11g0210300

Loading...