Os11t0213600-01

Locus

Os11g0213600

Description

Peptidase S10, serine carboxypeptidase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SCP48

CGSNL Gene Name

SERINE CARBOXYPEPTIDASE 48

Oryzabase Gene Symbol Synonym(s)

OsSCP48

Oryzabase Gene Name Synonym(s)

Serine carboxypeptidase 48

Transcript Evidence

AK103461 (DDBJ, Best hit)

Protein Evidence

NP_001151858.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Peptidase S10, serine carboxypeptidase (IPR001563)

Peptidase S10, serine carboxypeptidase, active site (IPR018202)

Full-length cDNA

J033129M07 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0213600-01)

RiceXPro (AK103461)

Others

Oryzabase (19226)

KEGG (Os11t0213600-01)

Transcript

1753 bp

>Os11t0213600-01 Peptidase S10, serine carboxypeptidase family protein.
ATCTCTTCCCAAGCTTCAACTTCAAGAACCCACCCACTTCTCCTCCTCTTCTCCATCCGC
TGCGGCAAGCGCGCAATTCAGTTGCTGCGAGCTCGCTCGCCGGCGACAATGGCGGCGGCG
GTGGCGGTGGTGGTTGGTTGCGTTCTTCTTGGTGGTGTGTGGGGGTTCCCGGAGGAGGAT
TTGGTGGCGCGGCTGCCGGGGCAGCCCGTCGTCGGGTTCAGGCAGTTCGCCGGATACGTC
GACGTCGACGAGAAGGCCGGGAGGAGCCTCTTCTACTACTTCGCCGAGGCGGCGGAGGGC
GCCGCCGCCAAGCCGCTCACCCTCTGGCTCAACGGAGGTCCTGGATGTTCTTCGGTTGGA
GGTGGCGCGTTCACAGAGCTCGGCCCATTTTATCCGAGAGGAGATGGCAGAGGCCTGAGA
TTGAACAAGAAGTCTTGGAACAAAGTATCCAATCTTCTGTTTGTTGAATCACCGGCTGGA
GTTGGATGGTCCTACTCCAACACTTCATCAGATTACAATACTGGCGATGCACAGACCGCT
AATGACATGTACAAATTTCTGTTGGGATGGTACAAGAAGTTCCCTGAATACAGGTCAAGA
GGGCTACTTCTTAGTGGAGAGAGCTATGCAGGGCATTATATACCGCAACTCACCGATGTA
CTTCTCACACATAATGAGAAATCAAATGGGTTCAAATTCAACATCAAGGGAGTAGCTATC
GGGAATCCGCTTCTCAAGCTTGACAGAGATGTCCCCGCAACATATGAGTATTTCTGGTCC
CATGGCATGATCTCTGACGAAATATTTCTATCAATCAGCCACAGTTGTGATTTTGAGGAC
TATACCTTTAGCAACCCCCACAATGAGAGCAAGTCATGCAATGATGCCATTGCAGAGGCA
AACAGTATAGTTGGGGATTATGTGAACAATTACGATGTTATTCTTGATGTGTGCTACCCA
TCAATTGTGATGCAGGAGCTACGGCTGCGGAAATATGTGACTAAAATGAGTGTAGGTGTG
GATGTTTGTATGACTTACGAAAGGTATTTCTATTTCAACCTTCCAGAAGTGCAGCAAGCT
CTTCATGCTAACAGAACACATTTGCCCTATGGCTGGAGCATGTGCAGCGATGTGCTGAAC
TACAGCAATAAGGATGGCAACATCAACATCTTGCCATTACTTCAGAGAATTGTAGAGCAC
AAAATACCAGTTTGGGTGTTCAGTGGAGATCAAGACTCTGTGGTGCCCCTATTGGGCTCC
CGAACTCTTGTACGAGAGCTAGCTCATGACATGGGCTTGCATGTCACAGTCCCATACAGC
AGCTGGTTCCGCAGAGGGCAGGTTGGAGGCTGGGTAACAGAGTATGGTAATATTCTGACC
TTTGCGACGGTGCGAGGAGCATCTCACATGGTGCCATTTGCGCAGCCAGACCGAGCTCTC
GGACTTTTTCAATCATTCGCACTTGGACGGAGACTCCCGAATACAACCCACCCACCTATT
AACTAAGTGTACCTACGAAAGGAGCTGAAGATACAAACAAATAGTCTAGGATTTTCAGTT
TTGCTACAGAAGATTAGTTCATAAGGGTGTATTAGATGGTCAAATACGAATATTTTATCT
ATTAGAGAGAACAGGGAAATAATACTAGATTAAATTCTTTATTGTTCTCTATCTGGATTG
TCAGATTGCATTCCTGGAAGTCTGGAACATTGAGCAATCTGTATAACTATGTCATTTTAG
GGGTTTTGGGGGC

CDS

1398 bp

>Os11t0213600-01 Peptidase S10, serine carboxypeptidase family protein.
ATGGCGGCGGCGGTGGCGGTGGTGGTTGGTTGCGTTCTTCTTGGTGGTGTGTGGGGGTTC
CCGGAGGAGGATTTGGTGGCGCGGCTGCCGGGGCAGCCCGTCGTCGGGTTCAGGCAGTTC
GCCGGATACGTCGACGTCGACGAGAAGGCCGGGAGGAGCCTCTTCTACTACTTCGCCGAG
GCGGCGGAGGGCGCCGCCGCCAAGCCGCTCACCCTCTGGCTCAACGGAGGTCCTGGATGT
TCTTCGGTTGGAGGTGGCGCGTTCACAGAGCTCGGCCCATTTTATCCGAGAGGAGATGGC
AGAGGCCTGAGATTGAACAAGAAGTCTTGGAACAAAGTATCCAATCTTCTGTTTGTTGAA
TCACCGGCTGGAGTTGGATGGTCCTACTCCAACACTTCATCAGATTACAATACTGGCGAT
GCACAGACCGCTAATGACATGTACAAATTTCTGTTGGGATGGTACAAGAAGTTCCCTGAA
TACAGGTCAAGAGGGCTACTTCTTAGTGGAGAGAGCTATGCAGGGCATTATATACCGCAA
CTCACCGATGTACTTCTCACACATAATGAGAAATCAAATGGGTTCAAATTCAACATCAAG
GGAGTAGCTATCGGGAATCCGCTTCTCAAGCTTGACAGAGATGTCCCCGCAACATATGAG
TATTTCTGGTCCCATGGCATGATCTCTGACGAAATATTTCTATCAATCAGCCACAGTTGT
GATTTTGAGGACTATACCTTTAGCAACCCCCACAATGAGAGCAAGTCATGCAATGATGCC
ATTGCAGAGGCAAACAGTATAGTTGGGGATTATGTGAACAATTACGATGTTATTCTTGAT
GTGTGCTACCCATCAATTGTGATGCAGGAGCTACGGCTGCGGAAATATGTGACTAAAATG
AGTGTAGGTGTGGATGTTTGTATGACTTACGAAAGGTATTTCTATTTCAACCTTCCAGAA
GTGCAGCAAGCTCTTCATGCTAACAGAACACATTTGCCCTATGGCTGGAGCATGTGCAGC
GATGTGCTGAACTACAGCAATAAGGATGGCAACATCAACATCTTGCCATTACTTCAGAGA
ATTGTAGAGCACAAAATACCAGTTTGGGTGTTCAGTGGAGATCAAGACTCTGTGGTGCCC
CTATTGGGCTCCCGAACTCTTGTACGAGAGCTAGCTCATGACATGGGCTTGCATGTCACA
GTCCCATACAGCAGCTGGTTCCGCAGAGGGCAGGTTGGAGGCTGGGTAACAGAGTATGGT
AATATTCTGACCTTTGCGACGGTGCGAGGAGCATCTCACATGGTGCCATTTGCGCAGCCA
GACCGAGCTCTCGGACTTTTTCAATCATTCGCACTTGGACGGAGACTCCCGAATACAACC
CACCCACCTATTAACTAA

Protein

466 aa

>Os11t0213600-01 Peptidase S10, serine carboxypeptidase family protein.
MAAAVAVVVGCVLLGGVWGFPEEDLVARLPGQPVVGFRQFAGYVDVDEKAGRSLFYYFAE
AAEGAAAKPLTLWLNGGPGCSSVGGGAFTELGPFYPRGDGRGLRLNKKSWNKVSNLLFVE
SPAGVGWSYSNTSSDYNTGDAQTANDMYKFLLGWYKKFPEYRSRGLLLSGESYAGHYIPQ
LTDVLLTHNEKSNGFKFNIKGVAIGNPLLKLDRDVPATYEYFWSHGMISDEIFLSISHSC
DFEDYTFSNPHNESKSCNDAIAEANSIVGDYVNNYDVILDVCYPSIVMQELRLRKYVTKM
SVGVDVCMTYERYFYFNLPEVQQALHANRTHLPYGWSMCSDVLNYSNKDGNINILPLLQR
IVEHKIPVWVFSGDQDSVVPLLGSRTLVRELAHDMGLHVTVPYSSWFRRGQVGGWVTEYG
NILTFATVRGASHMVPFAQPDRALGLFQSFALGRRLPNTTHPPIN*

5'UTR

chr11:5902586..5902693 (- strand) : 108 bp

CDS

chr11:5902357..5902585 (- strand) : 229 bp

chr11:5901011..5901118 (- strand) : 108 bp

chr11:5900817..5900909 (- strand) : 93 bp

chr11:5900633..5900725 (- strand) : 93 bp

chr11:5900464..5900549 (- strand) : 86 bp

chr11:5900100..5900378 (- strand) : 279 bp

chr11:5899884..5900017 (- strand) : 134 bp

chr11:5899539..5899631 (- strand) : 93 bp

chr11:5899336..5899453 (- strand) : 118 bp

chr11:5899065..5899229 (- strand) : 165 bp

3'UTR

chr11:5898818..5899064 (- strand) : 247 bp

FASTA

>Os11t0213600-01 class=Sequence position=chr11:5898818..5902693 (- strand)
ATCTCTTCCC AAGCTTCAAC TTCAAGAACC CACCCACTTC TCCTCCTCTT CTCCATCCGC TGCGGCAAGC GCGCAATTCA
GTTGCTGCGA GCTCGCTCGC CGGCGACAAT GGCGGCGGCG GTGGCGGTGG TGGTTGGTTG CGTTCTTCTT GGTGGTGTGT
GGGGGTTCCC GGAGGAGGAT TTGGTGGCGC GGCTGCCGGG GCAGCCCGTC GTCGGGTTCA GGCAGTTCGC CGGATACGTC
GACGTCGACG AGAAGGCCGG GAGGAGCCTC TTCTACTACT TCGCCGAGGC GGCGGAGGGC GCCGCCGCCA AGCCGCTCAC
CCTCTGGCTC AACGGAGGTC AGTCTCTCTG CTTTTCTCTC TCTCTCTGAC TCTCTCTGCT GAGTTCTTGG ATCATACTGT
GTGATGTGAT GTGATGTGTT GTGTTTATTG GATTTGATCT TGAAGCATTG TGTTTTTTTC TCATCTTTTT CAAGTTGAGA
ATGAGATGTG ATTCTTGAAG AGAGGTTTGG ATTTTTTGTT TTGTTTTGTT TTAATCTTGG AGATTGGTGT GGATTTCTTC
CTTGATGTTT TTGTCTCTTG CTGCATGTCA GTGTCTCACT CGGTTCTCTG AACTTTCTCT GATTGTTTTC TTCTGAATTT
TTCTTATGGA GGTATGCTGA CTGTGGAGAT GGTAGAGTCT CACTGTTGTT TGATAGAGAT TGCTCCCTTT ATGTGCATGG
CTTTCGGTTG ATTCCTTCTA GTATGGTTTT CTTTTTGTAT CCGTTTGGAT CTCCACTGTT TGTGCAACTA TTTCTGAATT
CTTTTCATGA ACAGATGGAA TTGGAGTTGT CATTGTCAAT GGTACTGTGT ACTACTGTTC CATTAATATT TTAATGGAGA
CAACTTTTTT TTTGGCCATT TTATGAGTTG TGAAGCCAGG AAATGAGCTT CCATTTACCA TCTTCTCTGA TCTCTTCTCA
GATGCAAAAA TGTATTTTTT TTCTATTTTC ATTTTGTTCA TATATATTCT CCATGTTTTT TCATCAGGGG ACTATGATGG
CAGGAGGTGT TTCCTGAACT GGAAACATAA AAAGAACTAC ATCTGCTCTA CACCTTCCAA GAAAAAAGAA ATCAAAAATA
ATTTTAACTT GCATGTTGAT ATCCTTTTCA CTAGTACTCC TACTACTTTG CAACTTGCAA AGGAGGAATA GGGTATCTTT
GAGGTCACCA TGTGTCCTTG GACCCTTGCC TCATTGGTGT CTGTGTGATG TGGTCCTAGA GCATTTAAAA AGAAGTGATG
CATCATTTGA TTTCCATGTA GCAAAAGACT ACCTAAAGAA ATGATTTCCA TGTAGCAAAA GACTACCTAA AGTTTTAGGT
AGCATTTTTA GACCAGTTTT AGGTATCATT TGGTTTCATC TCCATCATTC CATGCACAAA ATGAAGTTAG GGGTGAATTT
TTTCCATGGA ACAATACATT GTCACATAAT GAACTGTGAA CAACTTTAAT GCTACAGAAT CAAATGTGAC TTGCTGATTG
CCAATGTTTG CTGTAAGATT AACTGATTTA TAACCGCTGG CCATGTTGTT ATCAGGTCCT GGATGTTCTT CGGTTGGAGG
TGGCGCGTTC ACAGAGCTCG GCCCATTTTA TCCGAGAGGA GATGGCAGAG GCCTGAGATT GAACAAGAAG TCTTGGAACA
AAGGTTGAAC TTTTAGTTGC AATCTCCACC CAGCACATGT TTTCAGAATG CATAAAAAAT GTAGCTTTAG CTCTAACTGT
GTTACCTTAC CTCAAATTTT GCAGTATCCA ATCTTCTGTT TGTTGAATCA CCGGCTGGAG TTGGATGGTC CTACTCCAAC
ACTTCATCAG ATTACAATAC TGGCGATGCA CAGACCGGTA AGTTCTAATG ATGTTTCTTC AGATGAAAAG GACCAGTTAA
ACTTGAATAT GTTGGCCTGA CTGTATGTAT GCCTGCTCAA CTATGCAGCT AATGACATGT ACAAATTTCT GTTGGGATGG
TACAAGAAGT TCCCTGAATA CAGGTCAAGA GGGCTACTTC TTAGTGGAGA GAGCTATGCA GGTCAGAGAG TATTCCTGAG
TCTTATTTCA CATTTAAATG TTTAAATTCT GTCGTGCACT TTGACTGATT GGCGAATAAT TCAGGGCATT ATATACCGCA
ACTCACCGAT GTACTTCTCA CACATAATGA GAAATCAAAT GGGTTCAAAT TCAACATCAA GGGAGTAGCT GTAAGAATTT
GATCGCACAT TGGTCAATAT CTGTTAACTT TGTTCTTCTA AATGTTTTCT GTAACTCTGA TATTACCTTG AATAGATCGG
GAATCCGCTT CTCAAGCTTG ACAGAGATGT CCCCGCAACA TATGAGTATT TCTGGTCCCA TGGCATGATC TCTGACGAAA
TATTTCTATC AATCAGCCAC AGTTGTGATT TTGAGGACTA TACCTTTAGC AACCCCCACA ATGAGAGCAA GTCATGCAAT
GATGCCATTG CAGAGGCAAA CAGTATAGTT GGGGATTATG TGAACAATTA CGATGTTATT CTTGATGTGT GCTACCCATC
AATTGTGATG CAGGAGCTAC GGCTGCGGAA ATATGTATGC TTACTCTTGT TGATACAATC TTCTACTTGA GAACATATGG
TCCCTTGTGG TATGACTGAA TTGTTGTTCT ATGCAGGTGA CTAAAATGAG TGTAGGTGTG GATGTTTGTA TGACTTACGA
AAGGTATTTC TATTTCAACC TTCCAGAAGT GCAGCAAGCT CTTCATGCTA ACAGAACACA TTTGCCCTAT GGCTGGAGCA
TGTGCAGCGA GTAAGTATTT ATCTGTCAAC TTCTGTCTAT TATCTGTTTC TTCTAAGTAC TTCGGATGCT GTAAGTACGG
ACTCAATGAG TATAACTGTA GGCCCTTCTA GTAAAGTTTC AAATAGATAT TTTTCTAATG AAACTACCGA TGATTTGAAA
TTTTTTTAGA AAATATTTAT CATGTATAGA ATGCCAAATA GTATTTAGTG AACAGGCCTT AGTTTCCAAG TCTAACTCAT
ATTGAACATT TACATGTGCC AGTGTGCTGA ACTACAGCAA TAAGGATGGC AACATCAACA TCTTGCCATT ACTTCAGAGA
ATTGTAGAGC ACAAAATACC AGTTTGGGTG TTCAGGTAAT GTGTATTTCC ACTTATATTC CAGATAATTT GTTTCTGTTT
AATGTGAAGA ATGTTATGAC AATATCAATT GACACTACAG TGGAGATCAA GACTCTGTGG TGCCCCTATT GGGCTCCCGA
ACTCTTGTAC GAGAGCTAGC TCATGACATG GGCTTGCATG TCACAGTCCC ATACAGCAGC TGGTTCCGCA GAGGGCAGGT
ATACTTTCGC CCTTTTAAAC AAATTAGCTG ATACACTATG AAAACATAAT GCAAATTTGT GAAAGTTACT AATAGTTGAA
ATATGTGACC CTTTGGCATT CAAGGTTGGA GGCTGGGTAA CAGAGTATGG TAATATTCTG ACCTTTGCGA CGGTGCGAGG
AGCATCTCAC ATGGTGCCAT TTGCGCAGCC AGACCGAGCT CTCGGACTTT TTCAATCATT CGCACTTGGA CGGAGACTCC
CGAATACAAC CCACCCACCT ATTAACTAAG TGTACCTACG AAAGGAGCTG AAGATACAAA CAAATAGTCT AGGATTTTCA
GTTTTGCTAC AGAAGATTAG TTCATAAGGG TGTATTAGAT GGTCAAATAC GAATATTTTA TCTATTAGAG AGAACAGGGA
AATAATACTA GATTAAATTC TTTATTGTTC TCTATCTGGA TTGTCAGATT GCATTCCTGG AAGTCTGGAA CATTGAGCAA
TCTGTATAAC TATGTCATTT TAGGGGTTTT GGGGGC