Os11t0221000-01

Locus

Os11g0221000

Description

Aux/IAA_ARF_dimerisation domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA27

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA27

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 27

Transcript Evidence

AK102073 (DDBJ, Best hit)

Protein Evidence

P0C129 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J033082G16 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0221000-01)

RiceXPro (AK102073)

Others

Oryzabase (10914)

KEGG (Os11t0221000-01)

Transcript

2984 bp

>Os11t0221000-01 Aux/IAA_ARF_dimerisation domain containing protein.
ATCAACCACTAGTGCACCATCTTATATTCTTCCTACATATTCATTCTCCCCACAACAACA
ACTAACACTACTCACTCTTCATTGCTTTTTTTTTTCTCTCTCTAGCTAGCTAGCTTGCTT
CTACTTCTTCTTCATCTTGATCTTGAAACTAGTCTTATCAATCTGAGGAATTAATCCATC
ATTATGATGAATCTTATATCATTTGAAACACCTCCTCTTGGGAGGAGGAGTCAAGATGGA
GGCAGCAGCAGCAGCAGCATCACTGCTGCTACAACCACTACCAACAAGGCAAAGGAAGCA
GCAAGCCATCTAGACCTCAGCCTCGGCATCTCCTTGTCACCCGGCGGCGGCGGCGGCGAC
GCTGGCACCAAGGCCAGCAGCTGCTGCTACGGCGGCGGCGGCGACGGCGGCGGCTGCATG
GGCAGTGGCATGCTCACTGCAGGAGTTCTTGGCGTTGGGCATGGGGGGAGTAGCCATGAC
AATACTACGGCGAGCAGCGGCGGCGGCGGCAGCTGGACGGCGGCGTTCATGCCGAGCCCG
ACGGGATTCATGCACCCGTGGAGCCTCGCCGCCCGGCAGCAGAAGGCCGCCGCCGAGCAG
GAGCGGAGCGGCGTCGCGAGGCTGCCGCCGGCGACGACGACGTACATGCCAAGAGCTGCC
GCGACCGTGATTTCACTGCCGGCGGCAGTTGGCTGGCCACCGGTGCACACATCCCGGCGT
AACCTCGTTGCCACCATAAATAATGTCCTGAAACCCGACACTACTGCCGCCGTCAAGCCG
GACAGACCGACACAAGCAACGGCGATGTTCGCCGCCGACGAAACCACGGCGCCCCCGCCA
AGGAGCGCGGCGGCGGCGACCGAGGCCAGCAGGACATTGAACATGTTTGCCAAGGTGCAC
ATGGATGGGTACAAGGTGGGCAGGAAGATCAACCTCAGGGCACACCGCAACTACGACTCC
CTCCGTCGGGTCCTCACCAAGATGACTCATAATTTCTTCTGCCGTGAGTACCCTATATTT
CTTTTTTACTTTTTTTTAATTACTGGATAGACACAGACGCACACACGTATCACTAGACTC
GTAACACCACACTTACACCTCCACAAATACACTCCCTAATATATCATTATCTCATTAAAT
TCTGAGTACCCCATATTTCAACTCTATCTACAACAAAGTGCCTTGGTATCATATCTATCT
GTTCTTTAACTCCATAGATATATAATATATATTTTACAAGGGAAATAGGTAGAGTTAGTT
ATGTGTATGATTTAGGGTAGATACCAAACACATTAAAATGATTCTGGTCCCGTGACCAAG
ATAGAATTAATTAAAATGCAGACATGGCCCATGAATCGTATTATGTGACATGAGCAAACT
AAACATAGTTTGGTCCCACCTCATAGAGTCATAGGTTTTGTCTTTTTAAGGAAGGTTAGA
GCATGCTAATTGTTTAGGTCCAATTGAATTTACAGGTCACCCCTTGAGCAGTCAAACAAG
TTCTTCAAACTCTGTAGTAATTTGTGCTAGTCCAACTAGCCTCTCAAGAGTTATTTGCTC
ATTTTTCTCCATTTGTTTGAATGAACATGTCACAATAATATCTTGCAACTCAATAGTTAA
TTTATATCTTGCATGTTTTTAGAAGAGTCAACCATCTCGGCCCTCGTGATTACCCCATGA
TTGTGCTAGGTTTTAATTCATTTACCTTTAATTAACTATGCCATTGTAAGTTTTTCTAGT
TTGGGTTTTTTTATAAATTAAATCAAATCTATTCTTCTATAGTAATTTGCATAAGCTCCC
TACCCTTTTCGAAGGTTATGCGTACACGGAACATCCAACCTATAATGACTTGGCTAGAAA
TAATATCTAAGTAAAAAATGTTCCAAGTAATGAAGTGAATGCTATATTGCTTTTGGATTT
TTTTTATTGTACTACTAATATAAGGTATTAAAATGATTGTTCAAAATACTAAGTTCTTTT
TCATTTCACAAAATTCAGCCGCAGATTATTCAAGCACAAATAAGGGAGAAGAAGATTGTG
CTAAAAGTGACGAGTTCATATTTCTATATGAAGATTTTGAGGGCGACCGAATGCTTGTTG
GCGATGTCCCATGGGAGTAAGTATTTTTGTTAAAATAATTGATAGCTTTTTTATGCACTA
TTGTTGTTACAAAGTAATCCATCTCACTTAAGTTGTTGTCTCATGTACAAGTTATTGTTT
CATGTTAATTTGTTACTTCACAAATGCCATCCATAATAATATCGAAAGTGTAATAAAATG
TTTCTCGTATAAGGGTGCAATAACATTCTTGGGGCTCATGAGGGAAATATGTTACTATGT
CTGACTCACTAGTTCATTAATATTGTTTGCACATTCATAATTAATAAGATGTAAAAGGAG
AAAACCTTACTACACAATTAGTTTTCGAATATACAACAACTTTAAAATGCCCAAGTAACT
GTGCAATTTTGTAGGTTGTTCCTTGCATCAGCAAAAAGGTTGTACATTGCCAAAAACCCA
GCACCCAGAAACAAAGGTACCTACAGACCTCTTGTCTGGATATGCATGCTGCTTCCAAAA
GCTCCATATTGAAATGCTTCTTTTACGTGTTTGCTGTGCAATTACTTTGCAGAACATGCT
GAAATCGCCAAAAGGAAAGAAACTGAAGATGCAATAGATAACTGAAGGCACCTGAAAAGC
AAGTTGATCTCTGCATATACTACAATATGCACTTCTCATGATCTGACATATATAGCTCTC
GACTTGTGCTGTTCATCTTGTATTATAATAAGCTATCTTCGAAGAGTAGGTTTATAATGT
ACGGATGCATGTTAAAATGCTTCTTGATCACTGTGCATACAATTTTGCGGGCATTAGGTA
AGTACTCTGAAAAATGTACTAGACACGGATTCAGTATGTCTACACAAAGTGGATAAGACT
CGTCTAATAATTAACTACGTTCTTGCTTGCTATATTTTCCATCC

CDS

867 bp

>Os11t0221000-01 Aux/IAA_ARF_dimerisation domain containing protein.
ATGATGAATCTTATATCATTTGAAACACCTCCTCTTGGGAGGAGGAGTCAAGATGGAGGC
AGCAGCAGCAGCAGCATCACTGCTGCTACAACCACTACCAACAAGGCAAAGGAAGCAGCA
AGCCATCTAGACCTCAGCCTCGGCATCTCCTTGTCACCCGGCGGCGGCGGCGGCGACGCT
GGCACCAAGGCCAGCAGCTGCTGCTACGGCGGCGGCGGCGACGGCGGCGGCTGCATGGGC
AGTGGCATGCTCACTGCAGGAGTTCTTGGCGTTGGGCATGGGGGGAGTAGCCATGACAAT
ACTACGGCGAGCAGCGGCGGCGGCGGCAGCTGGACGGCGGCGTTCATGCCGAGCCCGACG
GGATTCATGCACCCGTGGAGCCTCGCCGCCCGGCAGCAGAAGGCCGCCGCCGAGCAGGAG
CGGAGCGGCGTCGCGAGGCTGCCGCCGGCGACGACGACGTACATGCCAAGAGCTGCCGCG
ACCGTGATTTCACTGCCGGCGGCAGTTGGCTGGCCACCGGTGCACACATCCCGGCGTAAC
CTCGTTGCCACCATAAATAATGTCCTGAAACCCGACACTACTGCCGCCGTCAAGCCGGAC
AGACCGACACAAGCAACGGCGATGTTCGCCGCCGACGAAACCACGGCGCCCCCGCCAAGG
AGCGCGGCGGCGGCGACCGAGGCCAGCAGGACATTGAACATGTTTGCCAAGGTGCACATG
GATGGGTACAAGGTGGGCAGGAAGATCAACCTCAGGGCACACCGCAACTACGACTCCCTC
CGTCGGGTCCTCACCAAGATGACTCATAATTTCTTCTGCCGTGAGTACCCTATATTTCTT
TTTTACTTTTTTTTAATTACTGGATAG

Protein

289 aa

>Os11t0221000-01 Aux/IAA_ARF_dimerisation domain containing protein.
MMNLISFETPPLGRRSQDGGSSSSSITAATTTTNKAKEAASHLDLSLGISLSPGGGGGDA
GTKASSCCYGGGGDGGGCMGSGMLTAGVLGVGHGGSSHDNTTASSGGGGSWTAAFMPSPT
GFMHPWSLAARQQKAAAEQERSGVARLPPATTTYMPRAAATVISLPAAVGWPPVHTSRRN
LVATINNVLKPDTTAAVKPDRPTQATAMFAADETTAPPPRSAAAATEASRTLNMFAKVHM
DGYKVGRKINLRAHRNYDSLRRVLTKMTHNFFCREYPIFLFYFFLITG*

5'UTR

chr11:6335893..6336075 (+ strand) : 183 bp

CDS

chr11:6336076..6336545 (+ strand) : 470 bp

chr11:6339979..6340375 (+ strand) : 397 bp

3'UTR

chr11:6340376..6342309 (+ strand) : 1934 bp

FASTA

>Os11t0221000-01 class=Sequence position=chr11:6335893..6342309 (+ strand)
ATCAACCACT AGTGCACCAT CTTATATTCT TCCTACATAT TCATTCTCCC CACAACAACA ACTAACACTA CTCACTCTTC
ATTGCTTTTT TTTTTCTCTC TCTAGCTAGC TAGCTTGCTT CTACTTCTTC TTCATCTTGA TCTTGAAACT AGTCTTATCA
ATCTGAGGAA TTAATCCATC ATTATGATGA ATCTTATATC ATTTGAAACA CCTCCTCTTG GGAGGAGGAG TCAAGATGGA
GGCAGCAGCA GCAGCAGCAT CACTGCTGCT ACAACCACTA CCAACAAGGC AAAGGAAGCA GCAAGCCATC TAGACCTCAG
CCTCGGCATC TCCTTGTCAC CCGGCGGCGG CGGCGGCGAC GCTGGCACCA AGGCCAGCAG CTGCTGCTAC GGCGGCGGCG
GCGACGGCGG CGGCTGCATG GGCAGTGGCA TGCTCACTGC AGGAGTTCTT GGCGTTGGGC ATGGGGGGAG TAGCCATGAC
AATACTACGG CGAGCAGCGG CGGCGGCGGC AGCTGGACGG CGGCGTTCAT GCCGAGCCCG ACGGGATTCA TGCACCCGTG
GAGCCTCGCC GCCCGGCAGC AGAAGGCCGC CGCCGAGCAG GAGCGGAGCG GCGTCGCGAG GCTGCCGCCG GCGACGACGA
CGTACATGCC AAGGTGAGAT ATATTTTTTA CTGATGATTA ATTAAAGTGT TAGTTAAAAT TATATGTACG TTGGACAGAG
CTAGATTCAG TTTAATTGTA GCAGCAAAGT AGTACAATTA ATTAATATAT ACGTGCATGA ATGTGCATGA TGCATCTGCA
TGGTTGAGAC TTGAGACTGA GCCAAAATGT AGTTTTTGTT CAGCACTGCA AACCTAGCTG AAGTGCTAAA CACATCGATC
TAAAATGTTC TAGCAGATGG ACATGTAACA TTTTTCAAGA GTCTTGCTGG AAACTGGTAC ACAAATAGAT AGTTTTCTTG
TGGCCAGTGT TGATCTTCTA TGGACAACTT TCTCTAATCA CCTACAAATA TACTTAAtcc ttttcagagt ataatttgtt
ttggttttat cccaagttaa attttgactt ctttaagtta aatcaagcat attgaaaagt gtaacaatat ttataataac
aaatttattt cataaaatcc tttgttatgt ttctataaat atatatattt tttcgtgttc aaaatgttga tactacattt
tttttcatac acttggtttg tacttgaaga aatttaattt aggataacag caacccatcc tatattctga aatggaggga
gtaTTATGTT CTCTTCATCA GTAATATATT GCTACTTGAT TAGAGTATAT TTGTGTAATC AAGATATAAT CTAGTTCTAC
ATACTTGAAG GGGAGAGCAG ATTCTAATTG ACCTACACGT ACAACGAATG ATTGCAATCA TGAACATTTT GCACCACTCA
TAGTTAAGTA TTTTGCAGAT CCTCGTGGGG TTAGAACTAC ACATTTAGAA ATTATTGCGA ATAGATTCTC TTTTGTGTGC
ACGGAGGACT AGTTCATGGC ATGCATGTAA CGTCCATATG TCAAGATCAC TCTACTTAGT AGCACGGTGA ATCTTTTTTT
TTTCATACTT AGGAGCCTCT ACATCAAGAT GTATTCAGCC AATTAACACA CCGGGGCATC ACATATAGTA CAGCATTTTA
AGCAAAAGGA AACTTATATA GGGATTACTT CCATGATAAA ACACACTTAT ATATTTATAT GTTCAAGCAA TAAGATGAGA
TTGAAACGGT CAGTGCAATG AAGATAAAAA TAATTTTCTC AAGAGGTAGT TTAAGGATTG GCAATAGCAT GTAAAAATAT
ATTTTCTCTT TTATTTTACA GTAGTTTGCT ATGGTTGCGG TACAATTTAG TGACTCTATA AAATATCTCT ACTGTCTTAT
AGACATAAAA AAAACCCCAT AGAAACATTT TATAAACTAC ATTTTCATAT GTAGCTAGAG AGAATTCAAC AAAAGTCACT
TATGGGGCAT TTGGAAAAAT GCCTCTGCAG TATTAGAAAA ATATCTCTAT ATAAGACATT TTTGTTGTTG TGTTTTTAGT
CAACTCGAAA AATGATATAA AATTTTATAT ATCCACTTAT TTTCTATCCA CGGTACAGTT ACTTCACTCT ATCGAACATT
CATGATGTTT AGCTCATGAT GCCTTTTATG TTCATAAATG GAAATGAAGA TGTTAGCTAA AGGTTTACAC TAATGATATA
CTGAACTATG AAGCATCACA ATCTTCAAAC AGCTTTATCC TGTATACCTA GTCAAAATAA CTTTGAAAAT TAAAGAAACA
CACTACGTTA GCTTTTTAGT TTTGCATTTT CCACTCATTT TTCAAACAAA GATAAATATC TATTTTGATT AAAAAATTGT
TGTGTAAGTA ATAGAAACAA GTAAATGTGT AATAGTCTTG TCAAGAAAAT TCGAATTTCC CCAACAGGTA ATCTGTAAAA
TTAGCAGCCG TCAGGGCTAA TCTTGTTTCC GGCATTGAAT TTTTACAAGA AAAAGCATGT AATTTCTCCA TGTGTTTAAG
TATCTCCTTA TTAGGAATTA AAACAAGGTA ACACAACTGA ATTAAAACCT TATATATCCA GAGTGAATAG AATAGAGTAA
ATTTATTAAT ATAGATATAT ATGAAAAGTA TGCTTTTGGA ATGTTACTGA GCTGGGCAGA GCTAGAAAAC AATATAACCA
TAGATTGCGC TGGAAGTCGT CTGGTCAGCT CACTCCGGCT GTTGTACTGT AGCTCCACCC CTGCAAAATG AATGTGTAAA
GAGATTTCTT ATAGTTCTGC ACTCCTGCCT TACGTTGTAG TGTTAATTTC CTGTAGCTGT AGGTACCTCA ACACTAGAAG
GGCACTAGCA AGATATACTG CAATTAAATT TGTAAAATAA ATTAATACTC CGTATGATTC CAAATGTAGG TCGGTTTAGA
TCGATTTATC CGCTCTTCTG CCATACATAC CTTCTTTTTT TCCCCTTTTA TGCCCTTGCT AAATAATGTC GCACTCTGTA
TAAATAAGGT ATCACTTCCA AAGTATAATA CTAGCAAAAT CGTAGCACAA TAACATCATT TGAACATTTC TTAATTCATG
TGCACTACTC atttgtgact agaaaaatat ccgtgcgtta caacaggtaa atgctatttt aattttattg ttgttatacg
gtttagttag cgtaaaattc actttgggaa tttgcttcga tatttctttt tgaaaaccat cagttgcaat taggagactg
tatatcatct caagttggca tgagagtttt tttaaacaga tttcttatac aactcctttt gtatttataa aagcaaatga
gcttaaaatc caactcaaat taacacggat ctgtatttct aaaagtgaac gaatttaaaa actgactcaa acacgaatgc
cgtaccaaaa taccggtaaa aacatcttta atttttataa tagtagagAT AGAGATTAGA GGAAGAGAAG AATACTAATA
ATTCCTCTCC AAATTAAAGG GAAAAACAAA AGGTGCATGC ACGAAATGGT TGGGCCTACA AGAGGGGAAT TTTCACTGCA
GGGGAGCAGC AATGATGAGG GTAGCATGGG TTGCTTGATT GTAGGCAGTG TAGTGCAGTC TTTTTGGTAA AACGACTTTT
CTGTCTCTAT ATGGATGTGT GCTCTAATAA TTGGACATCT GTGTGGTTGA TGTGAACATA TTTTTTTCCA TTTAATTAAT
TCAGGAAAAA AAATTAGTTC ATGCAAAAAT TAAATTTAAG ACAGAGAATT TGAATGCAAG GTTTTAAAAA TCACTTGTTT
CCCCTAGCAA TGCCCATTTC AAGATGATTA TTTGATGTTG TGCTGTTAAT CTCTGGACCA ATTTTACTCA TGTCTACTTG
TCCTTGAGTT GTACTAATAT ATTTGAAAGG AAAAAAATAA TTTCATCCTA AAAAATCTCT TTTAAATTAA AGGCTTCCAT
ATATACATTT GCTCATAGTT GTGCTAAATT ACTGCACAAA GTTGTTTTCT TTGACACTGA ATATATATTT TTTCTGCAAC
ATTTAGAGCT GCCGCGACCG TGATTTCACT GCCGGCGGCA GTTGGCTGGC CACCGGTGCA CACATCCCGG CGTAACCTCG
TTGCCACCAT AAATAATGTC CTGAAACCCG ACACTACTGC CGCCGTCAAG CCGGACAGAC CGACACAAGC AACGGCGATG
TTCGCCGCCG ACGAAACCAC GGCGCCCCCG CCAAGGAGCG CGGCGGCGGC GACCGAGGCC AGCAGGACAT TGAACATGTT
TGCCAAGGTG CACATGGATG GGTACAAGGT GGGCAGGAAG ATCAACCTCA GGGCACACCG CAACTACGAC TCCCTCCGTC
GGGTCCTCAC CAAGATGACT CATAATTTCT TCTGCCGTGA GTACCCTATA TTTCTTTTTT ACTTTTTTTT AATTACTGGA
TAGACACAGA CGCACACACG TATCACTAGA CTCGTAACAC CACACTTACA CCTCCACAAA TACACTCCCT AATATATCAT
TATCTCATTA AATTCTGAGT ACCCCATATT TCAACTCTAT CTACAACAAA GTGCCTTGGT ATCATATCTA TCTGTTCTTT
AACTCCATAG ATATATAATA TATATTTTAC AAGGGAAATA GGTAGAGTTA GTTATGTGTA TGATTTAGGG TAGATACCAA
ACACATTAAA ATGATTCTGG TCCCGTGACC AAGATAGAAT TAATTAAAAT GCAGACATGG CCCATGAATC GTATTATGTG
ACATGAGCAA ACTAAACATA GTTTGGTCCC ACCTCATAGA GTCATAGGTT TTGTCTTTTT AAGGAAGGTT AGAGCATGCT
AATTGTTTAG GTCCAATTGA ATTTACAGGT CACCCCTTGA GCAGTCAAAC AAGTTCTTCA AACTCTGTAG TAATTTGTGC
TAGTCCAACT AGCCTCTCAA GAGTTATTTG CTCATTTTTC TCCATTTGTT TGAATGAACA TGTCACAATA ATATCTTGCA
ACTCAATAGT TAATTTATAT CTTGCATGTT TTTAGAAGAG TCAACCATCT CGGCCCTCGT GATTACCCCA TGATTGTGCT
AGGTTTTAAT TCATTTACCT TTAATTAACT ATGCCATTGT AAGTTTTTCT AGTTTGGGTT TTTTTATAAA TTAAATCAAA
TCTATTCTTC TATAGTAATT TGCATAAGCT CCCTACCCTT TTCGAAGGTT ATGCGTACAC GGAACATCCA ACCTATAATG
ACTTGGCTAG AAATAATATC TAAGTAAAAA ATGTTCCAAG TAATGAAGTG AATGCTATAT TGCTTTTGGA TTTTTTTTAT
TGTACTACTA ATATAAGGTA TTAAAATGAT TGTTCAAAAT ACTAAGTTCT TTTTCATTTC ACAAAATTCA GCCGCAGATT
ATTCAAGCAC AAATAAGGGA GAAGAAGATT GTGCTAAAAG TGACGAGTTC ATATTTCTAT ATGAAGATTT TGAGGGCGAC
CGAATGCTTG TTGGCGATGT CCCATGGGAG TAAGTATTTT TGTTAAAATA ATTGATAGCT TTTTTATGCA CTATTGTTGT
TACAAAGTAA TCCATCTCAC TTAAGTTGTT GTCTCATGTA CAAGTTATTG TTTCATGTTA ATTTGTTACT TCACAAATGC
CATCCATAAT AATATCGAAA GTGTAATAAA ATGTTTCTCG TATAAGGGTG CAATAACATT CTTGGGGCTC ATGAGGGAAA
TATGTTACTA TGTCTGACTC ACTAGTTCAT TAATATTGTT TGCACATTCA TAATTAATAA GATGTAAAAG GAGAAAACCT
TACTACACAA TTAGTTTTCG AATATACAAC AACTTTAAAA TGCCCAAGTA ACTGTGCAAT TTTGTAGGTT GTTCCTTGCA
TCAGCAAAAA GGTTGTACAT TGCCAAAAAC CCAGCACCCA GAAACAAAGG TACCTACAGA CCTCTTGTCT GGATATGCAT
GCTGCTTCCA AAAGCTCCAT ATTGAAATGC TTCTTTTACG TGTTTGCTGT GCAATTACTT TGCAGAACAT GCTGAAATCG
CCAAAAGGAA AGAAACTGAA GATGCAATAG ATAACTGAAG GCACCTGAAA AGCAAGTTGA TCTCTGCATA TACTACAATA
TGCACTTCTC ATGATCTGAC ATATATAGCT CTCGACTTGT GCTGTTCATC TTGTATTATA ATAAGCTATC TTCGAAGAGT
AGGTTTATAA TGTACGGATG CATGTTAAAA TGCTTCTTGA TCACTGTGCA TACAATTTTG CGGGCATTAG GTAAGTACTC
TGAAAAATGT ACTAGACACG GATTCAGTAT GTCTACACAA AGTGGATAAG ACTCGTCTAA TAATTAACTA CGTTCTTGCT
TGCTATATTT TCCATCC

Locus: Os11g0221000

Loading...

Locus: Os11g0221000

Loading...