Os11t0221200-00

Locus

Os11g0221200

Description

Putative auxin-responsive protein IAA28.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA28

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA28

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 28

Transcript Evidence

P0C130 (UniProt)

Protein Evidence

P0C130 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Expression Databases

TENOR (Os11t0221200-00)

Others

Oryzabase (10915)

Transcript

489 bp

>Os11t0221200-00 Putative auxin-responsive protein IAA28.
ATGGGTAGGATGAAGGATAGGAATGCTTCTGCTGGGCCAGAGGTGAAGCCTGCAGGATTG
TCACCATCAAGGTTTGTGAAGGTCTTCATGCATGGGGAACCCTTTGAGAGGAAGATCAAT
TTGGCCATCCATAACAACTATGACTCTTTGTCCTTCACTTTAAAAAGATTGGGCAACAAC
TATTCCATGTCACCATTTGAACTTGAAGGCTTTGTGAACAATGAAGAAGATGGTGCCATA
GATAATGACTTTGATCTCCTGTACGATGACATGAATGGTGTTCGTTACTTACTTGGTGAA
GTCCCATGGGAGGTTTTCACCATTACAGTCAAAAGGATCTACATTGTTCCTGCAGAACAA
CAGAATGAAAGTGAATATCAGGAGGAGGAAGAGGACAACGCGGCTGCTGCTGCTACTGCT
GACGAAGATGTAGATGGAaatcactggtggagaaaccatctttggtcggtcggcccaatt
ttacaatag

CDS

489 bp

>Os11t0221200-00 Putative auxin-responsive protein IAA28.
ATGGGTAGGATGAAGGATAGGAATGCTTCTGCTGGGCCAGAGGTGAAGCCTGCAGGATTG
TCACCATCAAGGTTTGTGAAGGTCTTCATGCATGGGGAACCCTTTGAGAGGAAGATCAAT
TTGGCCATCCATAACAACTATGACTCTTTGTCCTTCACTTTAAAAAGATTGGGCAACAAC
TATTCCATGTCACCATTTGAACTTGAAGGCTTTGTGAACAATGAAGAAGATGGTGCCATA
GATAATGACTTTGATCTCCTGTACGATGACATGAATGGTGTTCGTTACTTACTTGGTGAA
GTCCCATGGGAGGTTTTCACCATTACAGTCAAAAGGATCTACATTGTTCCTGCAGAACAA
CAGAATGAAAGTGAATATCAGGAGGAGGAAGAGGACAACGCGGCTGCTGCTGCTACTGCT
GACGAAGATGTAGATGGAaatcactggtggagaaaccatctttggtcggtcggcccaatt
ttacaatag

Protein

163 aa

>Os11t0221200-00 Putative auxin-responsive protein IAA28.
MGRMKDRNASAGPEVKPAGLSPSRFVKVFMHGEPFERKINLAIHNNYDSLSFTLKRLGNN
YSMSPFELEGFVNNEEDGAIDNDFDLLYDDMNGVRYLLGEVPWEVFTITVKRIYIVPAEQ
QNESEYQEEEEDNAAAAATADEDVDGNHWWRNHLWSVGPILQ*

CDS

chr11:6348483..6348669 (+ strand) : 187 bp

chr11:6349156..6349279 (+ strand) : 124 bp

chr11:6349387..6349442 (+ strand) : 56 bp

chr11:6349637..6349758 (+ strand) : 122 bp

FASTA

>Os11t0221200-00 class=Sequence position=chr11:6348483..6349758 (+ strand)
ATGGGTAGGA TGAAGGATAG GAATGCTTCT GCTGGGCCAG AGGTGAAGCC TGCAGGATTG TCACCATCAA GGTTTGTGAA
GGTCTTCATG CATGGGGAAC CCTTTGAGAG GAAGATCAAT TTGGCCATCC ATAACAACTA TGACTCTTTG TCCTTCACTT
TAAAAAGATT GGGCAACAAC TATTCCAGTA AGCTCATTTC CATAAATTGC ATCCATATAC ATAATAAGTG GTCTGTTCAT
AAAGTTGTTT GTGCATAAAA CATAAATGGA TATGTAAGTG CGAATCACAT AGGAGAAATG ATGCATATTG GATCTAATAG
ATTGATTATA CTTGTTTGCA AGAAGCAGAT CTTAGCATGA ATATAGCTTG GGAAATTAAT TTATCAGTTT TACAATAAAA
AAATATATAT GCATCTCAAA TTCCTTTTTT TTTAATTCAC CAAGCTAGCT AGATTGTGTT CCAATTTGAT TTGTTGGGGT
GGTCGGCAAA TTAATACTTC TTGAAGATAG AGGAACAAAT TACATCTTAT TTACAAGTTA TAAACAAGTA TAAAATTATG
GAATACAGTA TCAATCAACC TTGTATTGAT TATGACACAA CAATACAAGC AATCTCAGAC ACAACAAAAT AACCTTGAAT
TATTTTGTTG TTAACTCTTC GTCAATTTCT TAGTGTCACC ATTTGAACTT GAAGGCTTTG TGAACAATGA AGAAGATGGT
GCCATAGATA ATGACTTTGA TCTCCTGTAC GATGACATGA ATGGTGTTCG TTACTTACTT GGTGAAGTCC CATGGGAGTA
AGTTCTTTCA TCTTAATCCA TGAATTTTTT ATTTGTTTCT TATCTTGAAC TTGATAATCA TATTAATTGT GACTGAAATA
GTAACAATTT AAACTATATT ACAGGGTTTT CACCATTACA GTCAAAAGGA TCTACATTGT TCCTGCAGAA CAACAGAATG
GTGTGTGAAA AACATATTAC TACTTAATTT CATCCATTTG TTCCTATACT ACCCCGTCCA TACCAGCAAA ATCTCAAAAC
AGCATAGTAG TAATTATGAT TCTTGAAAAT ATAGAATGTA TTTTATCTCA CTATTTTGGA GGATGTCTTA ATTACTGCCT
TCTATTTAAA ATTAATGCCA ATTAGTGGTT GCAGAAAGTG AATATCAGGA GGAGGAAGAG GACAACGCGG CTGCTGCTGC
TACTGCTGAC GAAGATGTAG ATGGAaatca ctggtggaga aaccatcttt ggtcggtcgg cccaatttta caatag

Locus: Os11g0221200

Loading...

Locus: Os11g0221200

Loading...