Os11t0221300-00

Locus

Os11g0221300

Description

AUX/IAA protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA29

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA29, OsEnS-141

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 29, endosperm-specific gene 141

Transcript Evidence

ab initio prediction

Protein Evidence

NP_001067526.2 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Expression Databases

TENOR (Os11t0221300-00)

Others

Oryzabase (10916)

KEGG (Os11t0221300-00)

Transcript

516 bp

>Os11t0221300-00 AUX/IAA protein family protein.
ATGAAGGATAGGAATGCTTCTGCTGAGCCTGTGGTGAAGCCAGGATTATCACCATCAAGA
TTTGTGAAGGTTTTCATGCATGGGGAACCCTTTGGGAGGAAGATCAATTTGGCTCTCCAT
AACAACTATGACTCTTTGTCCTTCACTTTAAAAAAATTGGGCAACAACTATTCCATGTCA
CCATTTGAACTTGAAGGCTTGGTGAACAAGGAAGAAGATGGTGCAATAGACAGCGACTTT
GACCTCTTGTATGATGATATGGATGGTGTTCGTTACTTCCTTGGTGATGTCCCATGGGAG
GTTTTCACCACTACAGTGAAAAAGATCTACATTGTCCCTGCAGAACAACAGAATGAAAAT
GATTATCAGGAGGAGGAAGAGGACAACGCGGCTGCTGCTGCTACTGCTGACGAAGATGGA
GATGGAGCTGCTGCTGACGATGGCGTTGCTGCTGCAGCTGACGACGTTGACGATGTTGCT
GGATACACGAGCAACGATGACCCAAGCTTCGACTGA

CDS

516 bp

>Os11t0221300-00 AUX/IAA protein family protein.
ATGAAGGATAGGAATGCTTCTGCTGAGCCTGTGGTGAAGCCAGGATTATCACCATCAAGA
TTTGTGAAGGTTTTCATGCATGGGGAACCCTTTGGGAGGAAGATCAATTTGGCTCTCCAT
AACAACTATGACTCTTTGTCCTTCACTTTAAAAAAATTGGGCAACAACTATTCCATGTCA
CCATTTGAACTTGAAGGCTTGGTGAACAAGGAAGAAGATGGTGCAATAGACAGCGACTTT
GACCTCTTGTATGATGATATGGATGGTGTTCGTTACTTCCTTGGTGATGTCCCATGGGAG
GTTTTCACCACTACAGTGAAAAAGATCTACATTGTCCCTGCAGAACAACAGAATGAAAAT
GATTATCAGGAGGAGGAAGAGGACAACGCGGCTGCTGCTGCTACTGCTGACGAAGATGGA
GATGGAGCTGCTGCTGACGATGGCGTTGCTGCTGCAGCTGACGACGTTGACGATGTTGCT
GGATACACGAGCAACGATGACCCAAGCTTCGACTGA

Protein

172 aa

>Os11t0221300-00 AUX/IAA protein family protein.
MKDRNASAEPVVKPGLSPSRFVKVFMHGEPFGRKINLALHNNYDSLSFTLKKLGNNYSMS
PFELEGLVNKEEDGAIDSDFDLLYDDMDGVRYFLGDVPWEVFTTTVKKIYIVPAEQQNEN
DYQEEEEDNAAAAATADEDGDGAAADDGVAAAADDVDDVAGYTSNDDPSFD*

CDS

chr11:6356838..6357012 (+ strand) : 175 bp

chr11:6357490..6357613 (+ strand) : 124 bp

chr11:6357770..6357825 (+ strand) : 56 bp

chr11:6358041..6358201 (+ strand) : 161 bp

FASTA

>Os11t0221300-00 class=Sequence position=chr11:6356838..6358201 (+ strand)
ATGAAGGATA GGAATGCTTC TGCTGAGCCT GTGGTGAAGC CAGGATTATC ACCATCAAGA TTTGTGAAGG TTTTCATGCA
TGGGGAACCC TTTGGGAGGA AGATCAATTT GGCTCTCCAT AACAACTATG ACTCTTTGTC CTTCACTTTA AAAAAATTGG
GCAACAACTA TTCCAGTAAG TCTGTTTCAA TATATTGCAT CCATACATAA AAAGTGATCT GTTCATAAAG TTATTTGTGC
TGTAAGTGCC TATCATATAG GAGAAATAAT GATGCATTTT GGATCTAATT AATAGACTTA TTACACTTGT TTGAAAGAAG
CATGTCTTAA CATGACTATA GCAAATATAT GGGGAATGAA TAATTAATTT ATCAGTTATT ACAGTCTAAA TATATGTACA
TCAAATTCCA ATTGTTTTTA TTCACCTAGC TAGATTGTTC CAATTTGTGT TTCTAGGGTG GTCGACAAAT TAATAAGGTT
GCTTGAATTG GAACAAAATA TTATTTACAA GTTATAAACA AGTATAAACA CTTGTGGAAT AGTAAACAAC CTTGTATTTA
TTGATTATAT CACAGAAATA TAAGCAATCT CCGACACTAG AATATAACCT TGTAATATTT GGTTGTTAAT TAACTACACC
TCAATTTCTT AGTGTCACCA TTTGAACTTG AAGGCTTGGT GAACAAGGAA GAAGATGGTG CAATAGACAG CGACTTTGAC
CTCTTGTATG ATGATATGGA TGGTGTTCGT TACTTCCTTG GTGATGTCCC ATGGGAGTAA GTCCTTTAAT TTCATCTTTA
TCCGTAGATG ATCTTCTATA GTTTCTTATC TCGAACCTGA TAGTTGATAA CCATATTCAT CGTGACGAAA ATAGTATCAA
TTTAATATTA TTACACACTA TATCTAAAAA CAATTTAACA TTATTGTTAC AGGGTTTTCA CCACTACAGT GAAAAAGATC
TACATTGTCC CTGCAGAACA ACAGAATGGT GCGTGAAACA ATATGTATAT TAACTTAATT AATCACAAGC ATTTCTCGTT
CCTATATACT ACTTCCATAT CAAGCAAGAT CTCAAATTAG CTTATTATCA ATTATATGAT TCTTGCAAAT ATGGATTGCA
TTTTATTTTT CACTCTTTTG GAGGATGTGT TAATTAATTA CTGCTTTTTC AATCCAAAAT TAATGCCAAT TAGTTGGTTG
CAGAAAATGA TTATCAGGAG GAGGAAGAGG ACAACGCGGC TGCTGCTGCT ACTGCTGACG AAGATGGAGA TGGAGCTGCT
GCTGACGATG GCGTTGCTGC TGCAGCTGAC GACGTTGACG ATGTTGCTGG ATACACGAGC AACGATGACC CAAGCTTCGA
CTGA

Locus: Os11g0221300

Loading...

Locus: Os11g0221300

Loading...