Os11t0222000-01

Locus

Os11g0222000

Description

Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCRR4

Oryzabase Gene Name Synonym(s)

CRINKLY4-RELATED protein 4

Transcript Evidence

AK288291 (DDBJ, Best hit)

Protein Evidence

NP_001176433.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Regulator of chromosome condensation/beta-lactamase-inhibitor protein II (IPR009091)

Protein kinase-like domain (IPR011009)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J090019D24 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0222000-01)

Others

Oryzabase (10380)

KEGG (Os11t0222000-01)

Transcript

3770 bp

>Os11t0222000-01 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
ACACTAGCTTGTGTGGTGGTGCCTTGCCATGTCCATGTCCACCCACCTGCCCCCTTGCTT
CTTCTCCCACCTCGCCTCCTCCCGCTGCGCTCTCCGATGCCGCCGTCTCGCCGCCATGGC
CATGGTGGTGCCCGCCTCCTCGTGTTCTTGCTGCCGGTGCTGCTCCTCCTGCGGACGGCG
GCGTCGAACACCTTGTCCACCTTCGCCATGGCCAAGGCGGAGTCCACGACGATAGTGTGC
GCGCTGCTGCCGTCGGCGGCGTCGCCGCTGCTCGTGGACCTCAATTGCACGGAGGCCGGC
GGCGACCACGAGCGGCAGGAGACGTACCcgtcgtcgcaccccttctccgcgctcgccggc
ggcgaccacttcctctgcgccgtcggcccgtcggcgCTCCGCGCCGGCGACGTCGCGATG
CGGTGGTGGGATCTGTCCAAGAACCGGACGAACACGCCGGAGACGAACGGGACGAAGGAT
GGTGGCGGGAGGTCGAAGAGGGTGTATCTCGGCCCGCCGATCCAGGCGCTGTCCTCCGGT
GGGTACCGTGTCTGCGGCGTGCTCTCCAGCGGCGAGCTCCACTGCTGGCGGTGGCGCGGG
CTGAAGATCCCCGACGGGCTCCGGTTCGTCTCCGTCGCCGTCGGCGACTGGTTCGTGTGC
GCCATCCAGGCGGCGCGGCCGGCGTCCATCCGGTGCTTCGGCAACGACACGGAGGCGGTA
AGCTCGGCGCCGGAGGGCGGGAGCTTCGACGTGGTGGCCGCGCACGGCCGCCGCGCGTGC
GCGCTGTCCACGTCCGGCGCGCTCTCGTGCTGGGGCCACGGCGCGCCGCTGGTGGGCGGC
GGCGAGGACGAGGCCACCACCGGGTACGCGGCGCTGGCATTGGGCACCGACGGCGTCTGC
GGGCTGCGCACCAACGGCACCATCCGCTGCTTCGGCGACGGCGTGGCGCCGCCGCCGGAC
AGCCTCGCGGGGTTCCAGTACGTCGACGTCCAGGCGCACGGGAGCGTCTTCTGCGGCGTC
CTCATGGCGAACTACTCCCTCGTCTGCTGGGGCGGGCACGAGTTCAACGCCACCAACCGC
CTGGTGTTCGACCGCGTCCTCCCGGGCCCGTGCGTGACCATGTCGTCATGCAGGTGCGGC
GTCCTGCCGGGCTCGGCCAACCTCTGCGCCTCCGGTCGCTGCATCTGCGTGGACTGCGCG
TTCGAGCTCAACGTCGCCACGCCCAACGCGTCGTCGCTCGGCCCTGGCCCCGGCAAGAGC
AGCAGCAAGCGGAGCAGGATCATCTGGGTCGCCGTCGCCGCGGGCGCGTTCCTCGTGCTG
CTCGTGGCATTGCAGTTCGCGCTGCTCATGTGGTGTCgccggcggcggcggcgcggcagg
ggcgggcaggcggaccaagcggcggcgatgtcgctgatgctgccgcggcatgggtcgagc
aaggggccgggcagcgtggtggagcatttcgccctggaggcgctccaggcggcgacggac
gggttctccgacgagcggcggatcgggtcggggagcttcgggtcggtgtaccgcggcacg
ctgaccgacgggcgggaggtggcgatcaagcgcgccgaggaccaggcgaagtcgtcgagc
tcggcggcgaggccggcgcggcggcgcgacagggagacggcgTTCAACTCGGAGCTCACC
GCGCTGGCGCGCGCCAACCACAAGAACATCGTGTGCCTCCTCGGCTGCTGCGCCGACGCC
GGCGAGCGCGTGCTGGTGTACGAGTACATGGCGAACGGCACCCTCCACGACCAGCTCCAC
GGCCGGAGCCCCATGGCGCCGCCGGTGTCGGCGTGGCGCggccgcctcaccatcgcgctc
gacgcggcgcgcggcatcgagtacatgcacgtctacgccgtgcccaacatcatccaccgc
gacatcaagtcggccaacatcctgctcgacgactcgtggacggccaagatcgccgacttc
ggCCTCTCCTCCATCCTAGATCCGGCCACCGCCGGCGGCGGCGGCGGCGGCGGCGGCGGC
GGCGAGGGGAGCAGCTCGAGGCCGCTGTACACGGGCGGCACGGTGGGGTACATGGACCCG
GAgtactaccggatgcagcacctgacggacaagagcgacgtgtacagcttcggggtggtg
ctcctggagctcatgtccgggtgccGCGTCGTGCAGCGCTACGCCGAGAGCGTGACGCCC
AAGAACGTGGTGGAGTTCGCCGTGCCGCACATCCTCGCCGACGAGGTGGCGCGGGTGCTC
GACCCGCGCATCCCGCCGCCGACGCCGCACGAGGCCGACGCGCTCGCCTACGTCGGCTAC
CTCGCCGCCGACTGCGTCGGCCCCGTCGGCTGCGACCGCCCGTCCATGACCGAGGTCGTC
GACGCCCTGGAGCGCGCCCTCGCCGCCTGCGCCGCCGCGTCGCTCTCCCGCTCCGGCACC
GTCACCGGCGCCGGCCGCCGCGCCCTCTCCCGCTCCGGGACAGACCAGTTTGACCTCACT
GACACTGACTAGCCACCCAATCCCGCGCCATTGACGCCATTGTCGCCGCCATGCCATCGC
TGACGCGATGTCCCTATCGGCATTGCGTCGTCGCCATTGGAGTCGCGTGCTGCAGCTAGC
TGGTCCTCGCGAAAGCAACGCCATGGGGAATCCATGGAATGGAGGAGAAGAAGAAGAAGA
AACCAAAAGCGACATCGACATCTCCGATGCTTCTGCTGCTCCTGCTGCTGCTGCTGCTGC
GAATTAATGGCGGGATTTCTTGGTGAGATCAATCTTCTCCATCTCCATGATCACGATGGG
ATTGCAGACTCGTTAACAACTTCACAGCGACATGGCACCGAATCATCCGAATGAATCGGT
TGAATGGAAACGAAAAAGGCCTGGCACGATTGGGGGCAAAAAAAAAAAAAAACCCATTCT
TTCCTGAAAATTTCTCTTCTTTTTTGTTCTTTCTTTTTTTTTCCCTGGCAGTGTGCACGA
ATTGGCGCTGTGTTTGTTCTATCTTTTCGCAAAAAAAGTTTTTCTTTTTCTCTTTGGTCA
TAAGGATTCTTTATTGGTGTGTATAGATTAGTCACAATTTTAGTGTTAGTAGGTGAGGAT
TAGGGACGACAGTGTATTTATTGATGTTTTCTTCATGTGTTCAGACACTGCAAAGATGAG
ATTTTTAAGGCGTAAGTTGCCGGCACAAATGCAAAGTTAATGTGAAACACTCGAGTGCAT
CCTCGAAACTTTTTTTTCCCTCTTGCAGCTAAATTATGACGACGATTGGTATTGTTTTTT
GTACACATTTGTGAGGTCAAAAAGGAGAAGGAAAAAAAAGATGAACTTTTTTTGTGTAGT
GCTCATCTTTCTTGCTCACTTCCCAATGCTTCTCCATTTCATTCTGGCAGTCTAGCTACT
TTGACATGTAAAGGTAGTTTGTTAAGCTTCTCGTCAGCTAACTTTCCATTGATCACATGA
ACTGCTGTTCCTTTCTGATGCATGCATGCCATCAAAGGCATCCTTTTATGCTTACCAAGC
TAAGTAGGATTCTTTGTTTAATTAGCTACAGGATTCTGTTAACTGAATAGGTTCCTTCCC
TTGTTGATTTCCTCCACCTAATTACTACTCTGGAAAAGAACAGAGAGAGCAGGTGTTCAT
GTAGACTGTTGTAGAAGAGAATCATTGGACTGACTTGTGTTGTAGGGGGATTATGTAAGC
CTAATCATTTTAGGTTAAATGAAATTGGACTGAAGTTGCTGTGTTAGCTG

CDS

2436 bp

>Os11t0222000-01 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
ATGCCGCCGTCTCGCCGCCATGGCCATGGTGGTGCCCGCCTCCTCGTGTTCTTGCTGCCG
GTGCTGCTCCTCCTGCGGACGGCGGCGTCGAACACCTTGTCCACCTTCGCCATGGCCAAG
GCGGAGTCCACGACGATAGTGTGCGCGCTGCTGCCGTCGGCGGCGTCGCCGCTGCTCGTG
GACCTCAATTGCACGGAGGCCGGCGGCGACCACGAGCGGCAGGAGACGTACCcgtcgtcg
caccccttctccgcgctcgccggcggcgaccacttcctctgcgccgtcggcccgtcggcg
CTCCGCGCCGGCGACGTCGCGATGCGGTGGTGGGATCTGTCCAAGAACCGGACGAACACG
CCGGAGACGAACGGGACGAAGGATGGTGGCGGGAGGTCGAAGAGGGTGTATCTCGGCCCG
CCGATCCAGGCGCTGTCCTCCGGTGGGTACCGTGTCTGCGGCGTGCTCTCCAGCGGCGAG
CTCCACTGCTGGCGGTGGCGCGGGCTGAAGATCCCCGACGGGCTCCGGTTCGTCTCCGTC
GCCGTCGGCGACTGGTTCGTGTGCGCCATCCAGGCGGCGCGGCCGGCGTCCATCCGGTGC
TTCGGCAACGACACGGAGGCGGTAAGCTCGGCGCCGGAGGGCGGGAGCTTCGACGTGGTG
GCCGCGCACGGCCGCCGCGCGTGCGCGCTGTCCACGTCCGGCGCGCTCTCGTGCTGGGGC
CACGGCGCGCCGCTGGTGGGCGGCGGCGAGGACGAGGCCACCACCGGGTACGCGGCGCTG
GCATTGGGCACCGACGGCGTCTGCGGGCTGCGCACCAACGGCACCATCCGCTGCTTCGGC
GACGGCGTGGCGCCGCCGCCGGACAGCCTCGCGGGGTTCCAGTACGTCGACGTCCAGGCG
CACGGGAGCGTCTTCTGCGGCGTCCTCATGGCGAACTACTCCCTCGTCTGCTGGGGCGGG
CACGAGTTCAACGCCACCAACCGCCTGGTGTTCGACCGCGTCCTCCCGGGCCCGTGCGTG
ACCATGTCGTCATGCAGGTGCGGCGTCCTGCCGGGCTCGGCCAACCTCTGCGCCTCCGGT
CGCTGCATCTGCGTGGACTGCGCGTTCGAGCTCAACGTCGCCACGCCCAACGCGTCGTCG
CTCGGCCCTGGCCCCGGCAAGAGCAGCAGCAAGCGGAGCAGGATCATCTGGGTCGCCGTC
GCCGCGGGCGCGTTCCTCGTGCTGCTCGTGGCATTGCAGTTCGCGCTGCTCATGTGGTGT
Cgccggcggcggcggcgcggcaggggcgggcaggcggaccaagcggcggcgatgtcgctg
atgctgccgcggcatgggtcgagcaaggggccgggcagcgtggtggagcatttcgccctg
gaggcgctccaggcggcgacggacgggttctccgacgagcggcggatcgggtcggggagc
ttcgggtcggtgtaccgcggcacgctgaccgacgggcgggaggtggcgatcaagcgcgcc
gaggaccaggcgaagtcgtcgagctcggcggcgaggccggcgcggcggcgcgacagggag
acggcgTTCAACTCGGAGCTCACCGCGCTGGCGCGCGCCAACCACAAGAACATCGTGTGC
CTCCTCGGCTGCTGCGCCGACGCCGGCGAGCGCGTGCTGGTGTACGAGTACATGGCGAAC
GGCACCCTCCACGACCAGCTCCACGGCCGGAGCCCCATGGCGCCGCCGGTGTCGGCGTGG
CGCggccgcctcaccatcgcgctcgacgcggcgcgcggcatcgagtacatgcacgtctac
gccgtgcccaacatcatccaccgcgacatcaagtcggccaacatcctgctcgacgactcg
tggacggccaagatcgccgacttcggCCTCTCCTCCATCCTAGATCCGGCCACCGCCGGC
GGCGGCGGCGGCGGCGGCGGCGGCGGCGAGGGGAGCAGCTCGAGGCCGCTGTACACGGGC
GGCACGGTGGGGTACATGGACCCGGAgtactaccggatgcagcacctgacggacaagagc
gacgtgtacagcttcggggtggtgctcctggagctcatgtccgggtgccGCGTCGTGCAG
CGCTACGCCGAGAGCGTGACGCCCAAGAACGTGGTGGAGTTCGCCGTGCCGCACATCCTC
GCCGACGAGGTGGCGCGGGTGCTCGACCCGCGCATCCCGCCGCCGACGCCGCACGAGGCC
GACGCGCTCGCCTACGTCGGCTACCTCGCCGCCGACTGCGTCGGCCCCGTCGGCTGCGAC
CGCCCGTCCATGACCGAGGTCGTCGACGCCCTGGAGCGCGCCCTCGCCGCCTGCGCCGCC
GCGTCGCTCTCCCGCTCCGGCACCGTCACCGGCGCCGGCCGCCGCGCCCTCTCCCGCTCC
GGGACAGACCAGTTTGACCTCACTGACACTGACTAG

Protein

812 aa

>Os11t0222000-01 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
MPPSRRHGHGGARLLVFLLPVLLLLRTAASNTLSTFAMAKAESTTIVCALLPSAASPLLV
DLNCTEAGGDHERQETYPSSHPFSALAGGDHFLCAVGPSALRAGDVAMRWWDLSKNRTNT
PETNGTKDGGGRSKRVYLGPPIQALSSGGYRVCGVLSSGELHCWRWRGLKIPDGLRFVSV
AVGDWFVCAIQAARPASIRCFGNDTEAVSSAPEGGSFDVVAAHGRRACALSTSGALSCWG
HGAPLVGGGEDEATTGYAALALGTDGVCGLRTNGTIRCFGDGVAPPPDSLAGFQYVDVQA
HGSVFCGVLMANYSLVCWGGHEFNATNRLVFDRVLPGPCVTMSSCRCGVLPGSANLCASG
RCICVDCAFELNVATPNASSLGPGPGKSSSKRSRIIWVAVAAGAFLVLLVALQFALLMWC
RRRRRRGRGGQADQAAAMSLMLPRHGSSKGPGSVVEHFALEALQAATDGFSDERRIGSGS
FGSVYRGTLTDGREVAIKRAEDQAKSSSSAARPARRRDRETAFNSELTALARANHKNIVC
LLGCCADAGERVLVYEYMANGTLHDQLHGRSPMAPPVSAWRGRLTIALDAARGIEYMHVY
AVPNIIHRDIKSANILLDDSWTAKIADFGLSSILDPATAGGGGGGGGGGEGSSSRPLYTG
GTVGYMDPEYYRMQHLTDKSDVYSFGVVLLELMSGCRVVQRYAESVTPKNVVEFAVPHIL
ADEVARVLDPRIPPPTPHEADALAYVGYLAADCVGPVGCDRPSMTEVVDALERALAACAA
ASLSRSGTVTGAGRRALSRSGTDQFDLTDTD*

5'UTR

chr11:6385342..6385437 (- strand) : 96 bp

CDS

chr11:6382906..6385341 (- strand) : 2436 bp

3'UTR

chr11:6381668..6382905 (- strand) : 1238 bp

FASTA

>Os11t0222000-01 class=Sequence position=chr11:6381668..6385437 (- strand)
ACACTAGCTT GTGTGGTGGT GCCTTGCCAT GTCCATGTCC ACCCACCTGC CCCCTTGCTT CTTCTCCCAC CTCGCCTCCT
CCCGCTGCGC TCTCCGATGC CGCCGTCTCG CCGCCATGGC CATGGTGGTG CCCGCCTCCT CGTGTTCTTG CTGCCGGTGC
TGCTCCTCCT GCGGACGGCG GCGTCGAACA CCTTGTCCAC CTTCGCCATG GCCAAGGCGG AGTCCACGAC GATAGTGTGC
GCGCTGCTGC CGTCGGCGGC GTCGCCGCTG CTCGTGGACC TCAATTGCAC GGAGGCCGGC GGCGACCACG AGCGGCAGGA
GACGTACCcg tcgtcgcacc ccttctccgc gctcgccggc ggcgaccact tcctctgcgc cgtcggcccg tcggcgCTCC
GCGCCGGCGA CGTCGCGATG CGGTGGTGGG ATCTGTCCAA GAACCGGACG AACACGCCGG AGACGAACGG GACGAAGGAT
GGTGGCGGGA GGTCGAAGAG GGTGTATCTC GGCCCGCCGA TCCAGGCGCT GTCCTCCGGT GGGTACCGTG TCTGCGGCGT
GCTCTCCAGC GGCGAGCTCC ACTGCTGGCG GTGGCGCGGG CTGAAGATCC CCGACGGGCT CCGGTTCGTC TCCGTCGCCG
TCGGCGACTG GTTCGTGTGC GCCATCCAGG CGGCGCGGCC GGCGTCCATC CGGTGCTTCG GCAACGACAC GGAGGCGGTA
AGCTCGGCGC CGGAGGGCGG GAGCTTCGAC GTGGTGGCCG CGCACGGCCG CCGCGCGTGC GCGCTGTCCA CGTCCGGCGC
GCTCTCGTGC TGGGGCCACG GCGCGCCGCT GGTGGGCGGC GGCGAGGACG AGGCCACCAC CGGGTACGCG GCGCTGGCAT
TGGGCACCGA CGGCGTCTGC GGGCTGCGCA CCAACGGCAC CATCCGCTGC TTCGGCGACG GCGTGGCGCC GCCGCCGGAC
AGCCTCGCGG GGTTCCAGTA CGTCGACGTC CAGGCGCACG GGAGCGTCTT CTGCGGCGTC CTCATGGCGA ACTACTCCCT
CGTCTGCTGG GGCGGGCACG AGTTCAACGC CACCAACCGC CTGGTGTTCG ACCGCGTCCT CCCGGGCCCG TGCGTGACCA
TGTCGTCATG CAGGTGCGGC GTCCTGCCGG GCTCGGCCAA CCTCTGCGCC TCCGGTCGCT GCATCTGCGT GGACTGCGCG
TTCGAGCTCA ACGTCGCCAC GCCCAACGCG TCGTCGCTCG GCCCTGGCCC CGGCAAGAGC AGCAGCAAGC GGAGCAGGAT
CATCTGGGTC GCCGTCGCCG CGGGCGCGTT CCTCGTGCTG CTCGTGGCAT TGCAGTTCGC GCTGCTCATG TGGTGTCgcc
ggcggcggcg gcgcggcagg ggcgggcagg cggaccaagc ggcggcgatg tcgctgatgc tgccgcggca tgggtcgagc
aaggggccgg gcagcgtggt ggagcatttc gccctggagg cgctccaggc ggcgacggac gggttctccg acgagcggcg
gatcgggtcg gggagcttcg ggtcggtgta ccgcggcacg ctgaccgacg ggcgggaggt ggcgatcaag cgcgccgagg
accaggcgaa gtcgtcgagc tcggcggcga ggccggcgcg gcggcgcgac agggagacgg cgTTCAACTC GGAGCTCACC
GCGCTGGCGC GCGCCAACCA CAAGAACATC GTGTGCCTCC TCGGCTGCTG CGCCGACGCC GGCGAGCGCG TGCTGGTGTA
CGAGTACATG GCGAACGGCA CCCTCCACGA CCAGCTCCAC GGCCGGAGCC CCATGGCGCC GCCGGTGTCG GCGTGGCGCg
gccgcctcac catcgcgctc gacgcggcgc gcggcatcga gtacatgcac gtctacgccg tgcccaacat catccaccgc
gacatcaagt cggccaacat cctgctcgac gactcgtgga cggccaagat cgccgacttc ggCCTCTCCT CCATCCTAGA
TCCGGCCACC GCCGGCGGCG GCGGCGGCGG CGGCGGCGGC GGCGAGGGGA GCAGCTCGAG GCCGCTGTAC ACGGGCGGCA
CGGTGGGGTA CATGGACCCG GAgtactacc ggatgcagca cctgacggac aagagcgacg tgtacagctt cggggtggtg
ctcctggagc tcatgtccgg gtgccGCGTC GTGCAGCGCT ACGCCGAGAG CGTGACGCCC AAGAACGTGG TGGAGTTCGC
CGTGCCGCAC ATCCTCGCCG ACGAGGTGGC GCGGGTGCTC GACCCGCGCA TCCCGCCGCC GACGCCGCAC GAGGCCGACG
CGCTCGCCTA CGTCGGCTAC CTCGCCGCCG ACTGCGTCGG CCCCGTCGGC TGCGACCGCC CGTCCATGAC CGAGGTCGTC
GACGCCCTGG AGCGCGCCCT CGCCGCCTGC GCCGCCGCGT CGCTCTCCCG CTCCGGCACC GTCACCGGCG CCGGCCGCCG
CGCCCTCTCC CGCTCCGGGA CAGACCAGTT TGACCTCACT GACACTGACT AGCCACCCAA TCCCGCGCCA TTGACGCCAT
TGTCGCCGCC ATGCCATCGC TGACGCGATG TCCCTATCGG CATTGCGTCG TCGCCATTGG AGTCGCGTGC TGCAGCTAGC
TGGTCCTCGC GAAAGCAACG CCATGGGGAA TCCATGGAAT GGAGGAGAAG AAGAAGAAGA AACCAAAAGC GACATCGACA
TCTCCGATGC TTCTGCTGCT CCTGCTGCTG CTGCTGCTGC GAATTAATGG CGGGATTTCT TGGTGAGATC AATCTTCTCC
ATCTCCATGA TCACGATGGG ATTGCAGACT CGTTAACAAC TTCACAGCGA CATGGCACCG AATCATCCGA ATGAATCGGT
TGAATGGAAA CGAAAAAGGC CTGGCACGAT TGGGGGCAAA AAAAAAAAAA AACCCATTCT TTCCTGAAAA TTTCTCTTCT
TTTTTGTTCT TTCTTTTTTT TTCCCTGGCA GTGTGCACGA ATTGGCGCTG TGTTTGTTCT ATCTTTTCGC AAAAAAAGTT
TTTCTTTTTC TCTTTGGTCA TAAGGATTCT TTATTGGTGT GTATAGATTA GTCACAATTT TAGTGTTAGT AGGTGAGGAT
TAGGGACGAC AGTGTATTTA TTGATGTTTT CTTCATGTGT TCAGACACTG CAAAGATGAG ATTTTTAAGG CGTAAGTTGC
CGGCACAAAT GCAAAGTTAA TGTGAAACAC TCGAGTGCAT CCTCGAAACT TTTTTTTCCC TCTTGCAGCT AAATTATGAC
GACGATTGGT ATTGTTTTTT GTACACATTT GTGAGGTCAA AAAGGAGAAG GAAAAAAAAG ATGAACTTTT TTTGTGTAGT
GCTCATCTTT CTTGCTCACT TCCCAATGCT TCTCCATTTC ATTCTGGCAG TCTAGCTACT TTGACATGTA AAGGTAGTTT
GTTAAGCTTC TCGTCAGCTA ACTTTCCATT GATCACATGA ACTGCTGTTC CTTTCTGATG CATGCATGCC ATCAAAGGCA
TCCTTTTATG CTTACCAAGC TAAGTAGGAT TCTTTGTTTA ATTAGCTACA GGATTCTGTT AACTGAATAG GTTCCTTCCC
TTGTTGATTT CCTCCACCTA ATTACTACTC TGGAAAAGAA CAGAGAGAGC AGGTGTTCAT GTAGACTGTT GTAGAAGAGA
ATCATTGGAC TGACTTGTGT TGTAGGGGGA TTATGTAAGC CTAATCATTT TAGGTTAAAT GAAATTGGAC TGAAGTTGCT
GTGTTAGCTG 

Locus: Os11g0222000

Loading...

Locus: Os11g0222000

Loading...