Os11t0225100-01

Locus

Os11g0225100

Description

Nucleotide binding site-leucine rich repeats (NBS-LRRs) protein, Resistance to the blast fungus, (Nippponbare: susceptible to the blast fungus carrying the AVR-Pia)

RAP-DB Gene Symbol Synonym(s)

Os11gRGA4, RGA4, Pia

RAP-DB Gene Name Synonym(s)

R-gene analog 4

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK066950

AB604624

Protein Evidence

F7J0M6

Literature

PMID: 23548743

PMID: 21251109

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

July 19, 2018

Gene Ontology (GO)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Leucine-rich repeat domain superfamily (IPR032675)

Virus X resistance protein-like, coiled-coil domain (IPR038005)

NB-ARC (IPR002182)

Full-length cDNA

J013090P15 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0225100-01)

Transcript

3710 bp

>Os11t0225100-01 Nucleotide binding site-leucine rich repeats (NBS-LRRs) protein, Resistance to the blast fungus, (Nippponbare: susceptible to the blast fungus carrying the AVR-Pia)
GTCAGTCTTCCCCTTCCCCAGCTCTCCATCGAATCGTAGCTTGTTGAAGGTGGAAGatgg
aggccgcgcttctgagcggattcatcaaggccatcctgccgaggctcttctccctcgtca
acgacaagctcaatctgcacaagggcgtcaagggcgacatcgatttcctcatcaaggagc
tccgcatgatcgtcggcgccatcgacgacgacctctccgtcgaacatggcgccgccgccg
ccgccgccgccgtaTCTCcatcgaatcgtagcttgttgaaggtggaagatggaggccgcg
cttctgagcggattcatcaaggccatcctgccgaggctcttctccctcgtcaacgacaag
ctcaatctgcacaagggcgtcaagggcgacatcgatttcctcatcaaggagctccgcatg
atcgtcggcgccatcgacgacgacctctccgtcgaacatggcgccgccgccgccgccgcc
gccgtacagacgctatgcatggaggacctccgcgagctcgcccacggcatcgaggactgc
atcgacggcgtcctgtaccgcgccgccagggagcagcggcgctcttcgtcgcttctcccc
cgcacggtccgggcaaccaagaagttgctacagacaaaccagcatctggcccaggagttg
cagcggctgaagaggatggtggaggaggcgaaccagcggaagcagaggtacacggcggcg
gcgcccggtcaacacggtcaggtctactcatcggctgcggcgcaggtggatgagccgtgg
ccgtcgtgctcatctgcctcagatccgcgcatccacgaggcggacctggtcggcgtcgac
gcggaccgggcggagctccttgagcagctggcggagcggcagccggagcagctcaaggtg
atcgccatcgtcgggttctgcgggctggggaagaccgccctcgccgcggaggcgtacaac
cgagagacccgcggcgggagattcgagaggcacgcgtgggtttgcgccgcgcaccggagt
gcacgggaggtgctcggcgaattgctccgcaggattgacgccgcttgccatggggactcc
gatgctggccagctgtgtgtagatatcagacaacagttggagaagaagaggtacttcatt
gttatcgatgacattcaaacagaagatcagtggaaaagcatcaaatcggcttttccgact
gataaggatattggcagcagaatagtggtcacgacgaccatccagtcagtagctaatgcc
tgctgttctgcgaatgggtatttgcacaaaatgagcaggcttgataagaactgctcaaag
caattgttgtccaagaaagcttgcccagagaggtattcacattacaagcagccagattca
gcagcaattttgaagaaatgtgatggccagccacttgctcttgttaccataggtgaattc
ctgcaagctaatggctggccaacggggcctaactgtgaagatctctgcaatcggctacat
tatcacctagagaatgataaaacacttgaaaggatgcggcgagtgctggtccgcaactac
actagtctacctggccatgctctcaaggcctgcttactatattttggtatgttcccatct
gatcatccaatcaggaggaaaagtctgttgaggcgatggctggccgagggatttgtagaa
ccagtgtcttcatctagtaacctagattccacggctgctttcgatgtgctaatggaccgg
aacattattgagcccatcaatgtaagcaataatgataaagtcaagacatgccaaacgtac
ggtatgatgcgtgaattcatatcgcatatgtcaatctctcagaactttgtcacctttttc
tgtgatgacaagttcctgcccaaatatgttcgtcggctttctctccatggtgacactgtt
gtgaatggcgataacttcaacggtattgatttatcacttgtacggtctctggtagtcttt
ggggaggcaggtacaactgtattagacttcagcaagtatcaattgctgcgagttttagat
cttgaaaaatgtgatgatttgaacgatgatcatctcaaagaaatatgcaatctggtgctt
ctgaaatatctgagccttgggggtaatatctccaaacttccaaaggatattgccaaattg
aaagatttggaggcactcgatgtaaggagatcgaaagtaaagataatgccggtagaagtc
ttcgggttgccatgcctaattcatctgcttggaaaatttaagctctcagataaagtcaag
cagaagactgaagtgcaagagtttctctcgaaaggaaaaagcaacttgcagacgctagca
ggatttgctagcaacggaagcgaagggtttctgcatcttatgaggtacatgaataagttg
agaaagttgaagatttggtgtacgtcgtctgcaggtagcaccgattggactgatcttagg
gaggccattcaacagttcattctggatgaaaaggaagcaaatattggtacccgttcttta
tcgcttcatttcactggatgctctgaagatgcgataaattccttaaaagaaccctgctac
ctcagctcgttgaaattacatggcaacttcccccaattgcctcagtttgttacatcactt
cgtggtctcaaggagctttgcctttcatctactaaatttacaacaggccttcttgaagcc
ttgagtaatttgagctacttgcagtatctcaaactggttgccgatgaacttgagaagttc
atcataaaagttcaggggttccccaggctgctatgcctttgtattgtgctacaatgtcca
acattcccagtaattgaagaaggagctctgccatttcttgtcacacttcagctgctatgc
aaagatctacatggcctttctgacatcaaaattgaatgttttaaacatcttcaggaggta
actcttcattctggagtcactccagctacaagacaggaatgggtaaaggctgctaaggag
catccgaataggccaaaagtattgcttctcaaatctgttgatacagcagaaagtgaACAT
ACAGACGTTGATAGTGTAATGGAGGCAGTCAAAAGTGAGACTACAGAATATTCTATTGCA
CCAGAGGGACCAGAACAAGTGATTGACATGAACAACAAAATGCAACTTGACCATGGATTG
GAATCCTCTTCTGTGCTGAACAAACAAAACAATTTTGCAGACCAATCAAGCTCAAAAGAT
CAACTGCATTATTCTTTCAACAATATGGGGCTTTCAGATGTCTCTCCTGCTGTGAGTGAG
CTGCCGAATGGCATGGTGCCTTCTTGTACATGACAAGGATCTAGAATCTTCACGTGGCTT
CCCGGTCAGTTATTTGGACCTGTTGCTTTCTGATTGTGCATTTTGTGTTTACTTGTCCTT
CACACAATCATCGTCATCAAAATACCTTTGATTTCCTACACTCCCTGTTACCTCCCTTGA
TGAAATCAGGGGGATTCATGGGCACAGCTACATGTTCTGTCTGCATTTTGTATAGTGACG
TGGCATACCTAGTACTTGTTTTGTCTCCATCCTGTTTGGCAGAGCAACAGGTTGTAATAA
ATCTTGGTTCTAACTGGCTGCCCTCAGAATATGTTGTCTATAGAATCCACCTGATAGGGA
ATTCGGCCGTTTGATAATCCTTTATTTTTAAGTCTATTGTTTGTCCTGAG

CDS

3045 bp

>Os11t0225100-01 Nucleotide binding site-leucine rich repeats (NBS-LRRs) protein, Resistance to the blast fungus, (Nippponbare: susceptible to the blast fungus carrying the AVR-Pia)
atggaggccgcgcttctgagcggattcatcaaggccatcctgccgaggctcttctccctc
gtcaacgacaagctcaatctgcacaagggcgtcaagggcgacatcgatttcctcatcaag
gagctccgcatgatcgtcggcgccatcgacgacgacctctccgtcgaacatggcgccgcc
gccgccgccgccgccgtacagacgctatgcatggaggacctccgcgagctcgcccacggc
atcgaggactgcatcgacggcgtcctgtaccgcgccgccagggagcagcggcgctcttcg
tcgcttctcccccgcacggtccgggcaaccaagaagttgctacagacaaaccagcatctg
gcccaggagttgcagcggctgaagaggatggtggaggaggcgaaccagcggaagcagagg
tacacggcggcggcgcccggtcaacacggtcaggtctactcatcggctgcggcgcaggtg
gatgagccgtggccgtcgtgctcatctgcctcagatccgcgcatccacgaggcggacctg
gtcggcgtcgacgcggaccgggcggagctccttgagcagctggcggagcggcagccggag
cagctcaaggtgatcgccatcgtcgggttctgcgggctggggaagaccgccctcgccgcg
gaggcgtacaaccgagagacccgcggcgggagattcgagaggcacgcgtgggtttgcgcc
gcgcaccggagtgcacgggaggtgctcggcgaattgctccgcaggattgacgccgcttgc
catggggactccgatgctggccagctgtgtgtagatatcagacaacagttggagaagaag
aggtacttcattgttatcgatgacattcaaacagaagatcagtggaaaagcatcaaatcg
gcttttccgactgataaggatattggcagcagaatagtggtcacgacgaccatccagtca
gtagctaatgcctgctgttctgcgaatgggtatttgcacaaaatgagcaggcttgataag
aactgctcaaagcaattgttgtccaagaaagcttgcccagagaggtattcacattacaag
cagccagattcagcagcaattttgaagaaatgtgatggccagccacttgctcttgttacc
ataggtgaattcctgcaagctaatggctggccaacggggcctaactgtgaagatctctgc
aatcggctacattatcacctagagaatgataaaacacttgaaaggatgcggcgagtgctg
gtccgcaactacactagtctacctggccatgctctcaaggcctgcttactatattttggt
atgttcccatctgatcatccaatcaggaggaaaagtctgttgaggcgatggctggccgag
ggatttgtagaaccagtgtcttcatctagtaacctagattccacggctgctttcgatgtg
ctaatggaccggaacattattgagcccatcaatgtaagcaataatgataaagtcaagaca
tgccaaacgtacggtatgatgcgtgaattcatatcgcatatgtcaatctctcagaacttt
gtcacctttttctgtgatgacaagttcctgcccaaatatgttcgtcggctttctctccat
ggtgacactgttgtgaatggcgataacttcaacggtattgatttatcacttgtacggtct
ctggtagtctttggggaggcaggtacaactgtattagacttcagcaagtatcaattgctg
cgagttttagatcttgaaaaatgtgatgatttgaacgatgatcatctcaaagaaatatgc
aatctggtgcttctgaaatatctgagccttgggggtaatatctccaaacttccaaaggat
attgccaaattgaaagatttggaggcactcgatgtaaggagatcgaaagtaaagataatg
ccggtagaagtcttcgggttgccatgcctaattcatctgcttggaaaatttaagctctca
gataaagtcaagcagaagactgaagtgcaagagtttctctcgaaaggaaaaagcaacttg
cagacgctagcaggatttgctagcaacggaagcgaagggtttctgcatcttatgaggtac
atgaataagttgagaaagttgaagatttggtgtacgtcgtctgcaggtagcaccgattgg
actgatcttagggaggccattcaacagttcattctggatgaaaaggaagcaaatattggt
acccgttctttatcgcttcatttcactggatgctctgaagatgcgataaattccttaaaa
gaaccctgctacctcagctcgttgaaattacatggcaacttcccccaattgcctcagttt
gttacatcacttcgtggtctcaaggagctttgcctttcatctactaaatttacaacaggc
cttcttgaagccttgagtaatttgagctacttgcagtatctcaaactggttgccgatgaa
cttgagaagttcatcataaaagttcaggggttccccaggctgctatgcctttgtattgtg
ctacaatgtccaacattcccagtaattgaagaaggagctctgccatttcttgtcacactt
cagctgctatgcaaagatctacatggcctttctgacatcaaaattgaatgttttaaacat
cttcaggaggtaactcttcattctggagtcactccagctacaagacaggaatgggtaaag
gctgctaaggagcatccgaataggccaaaagtattgcttctcaaatctgttgatacagca
gaaagtgaACATACAGACGTTGATAGTGTAATGGAGGCAGTCAAAAGTGAGACTACAGAA
TATTCTATTGCACCAGAGGGACCAGAACAAGTGATTGACATGAACAACAAAATGCAACTT
GACCATGGATTGGAATCCTCTTCTGTGCTGAACAAACAAAACAATTTTGCAGACCAATCA
AGCTCAAAAGATCAACTGCATTATTCTTTCAACAATATGGGGCTTTCAGATGTCTCTCCT
GCTGTGAGTGAGCTGCCGAATGGCATGGTGCCTTCTTGTACATGA

Protein

1015 aa

>Os11t0225100-01 Nucleotide binding site-leucine rich repeats (NBS-LRRs) protein, Resistance to the blast fungus, (Nippponbare: susceptible to the blast fungus carrying the AVR-Pia)
MEAALLSGFIKAILPRLFSLVNDKLNLHKGVKGDIDFLIKELRMIVGAIDDDLSVEHGAA
AAAAAVQTLCMEDLRELAHGIEDCIDGVLYRAAREQRRSSSLLPRTVRATKKLLQTNQHL
AQELQRLKRMVEEANQRKQRYTAAAPGQHGQVYSSAAAQVDEPWPSCSSASDPRIHEADL
VGVDADRAELLEQLAERQPEQLKVIAIVGFCGLGKTALAAEAYNRETRGGRFERHAWVCA
AHRSAREVLGELLRRIDAACHGDSDAGQLCVDIRQQLEKKRYFIVIDDIQTEDQWKSIKS
AFPTDKDIGSRIVVTTTIQSVANACCSANGYLHKMSRLDKNCSKQLLSKKACPERYSHYK
QPDSAAILKKCDGQPLALVTIGEFLQANGWPTGPNCEDLCNRLHYHLENDKTLERMRRVL
VRNYTSLPGHALKACLLYFGMFPSDHPIRRKSLLRRWLAEGFVEPVSSSSNLDSTAAFDV
LMDRNIIEPINVSNNDKVKTCQTYGMMREFISHMSISQNFVTFFCDDKFLPKYVRRLSLH
GDTVVNGDNFNGIDLSLVRSLVVFGEAGTTVLDFSKYQLLRVLDLEKCDDLNDDHLKEIC
NLVLLKYLSLGGNISKLPKDIAKLKDLEALDVRRSKVKIMPVEVFGLPCLIHLLGKFKLS
DKVKQKTEVQEFLSKGKSNLQTLAGFASNGSEGFLHLMRYMNKLRKLKIWCTSSAGSTDW
TDLREAIQQFILDEKEANIGTRSLSLHFTGCSEDAINSLKEPCYLSSLKLHGNFPQLPQF
VTSLRGLKELCLSSTKFTTGLLEALSNLSYLQYLKLVADELEKFIIKVQGFPRLLCLCIV
LQCPTFPVIEEGALPFLVTLQLLCKDLHGLSDIKIECFKHLQEVTLHSGVTPATRQEWVK
AAKEHPNRPKVLLLKSVDTAESEHTDVDSVMEAVKSETTEYSIAPEGPEQVIDMNNKMQL
DHGLESSSVLNKQNNFADQSSSKDQLHYSFNNMGLSDVSPAVSELPNGMVPSCT*

5'UTR

chr11:6545739..6546026 (- strand) : 288 bp

CDS

chr11:6544897..6545738 (- strand) : 842 bp

chr11:6542301..6544503 (- strand) : 2203 bp

3'UTR

chr11:6541924..6542300 (- strand) : 377 bp

FASTA

>Os11t0225100-01 class=Sequence position=chr11:6541924..6546026 (- strand)
GTCAGTCTTC CCCTTCCCCA GCTCTCCATC GAATCGTAGC TTGTTGAAGG TGGAAGatgg aggccgcgct tctgagcgga
ttcatcaagg ccatcctgcc gaggctcttc tccctcgtca acgacaagct caatctgcac aagggcgtca agggcgacat
cgatttcctc atcaaggagc tccgcatgat cgtcggcgcc atcgacgacg acctctccgt cgaacatggc gccgccgccg
ccgccgccgc cgtaTCTCca tcgaatcgta gcttgttgaa ggtggaagat ggaggccgcg cttctgagcg gattcatcaa
ggccatcctg ccgaggctct tctccctcgt caacgacaag ctcaatctgc acaagggcgt caagggcgac atcgatttcc
tcatcaagga gctccgcatg atcgtcggcg ccatcgacga cgacctctcc gtcgaacatg gcgccgccgc cgccgccgcc
gccgtacaga cgctatgcat ggaggacctc cgcgagctcg cccacggcat cgaggactgc atcgacggcg tcctgtaccg
cgccgccagg gagcagcggc gctcttcgtc gcttctcccc cgcacggtcc gggcaaccaa gaagttgcta cagacaaacc
agcatctggc ccaggagttg cagcggctga agaggatggt ggaggaggcg aaccagcgga agcagaggta cacggcggcg
gcgcccggtc aacacggtca ggtctactca tcggctgcgg cgcaggtgga tgagccgtgg ccgtcgtgct catctgcctc
agatccgcgc atccacgagg cggacctggt cggcgtcgac gcggaccggg cggagctcct tgagcagctg gcggagcggc
agccggagca gctcaaggtg atcgccatcg tcgggttctg cgggctgggg aagaccgccc tcgccgcgga ggcgtacaac
cgagagaccc gcggcgggag attcgagagg cacgcgtggg tttgcgccgc gcaccggagt gcacgggagg tgctcggcga
attgctccgc aggattgacg ccgcttgcca tggggactcc gatgctggcc agctgtgtgt agatatcaga caacagttgg
agaagaagag gtgaaaaatc tcaactttct gcttgaattg cctgatccat ttttcacatg aatttgaggt caacatttta
gtcaactcgc ctgttctttt gcacaagttc agtgcgactg acactttcaa tagcaaagtg aatcatgaac agatactata
tcttgctaac tgctaggtgt tagctgcact aatttagtca tcaaatgcat acagtgcatt tctcatgcgc tttatctttt
acaaatttac tataatagaa taaaaatgga aaaaacaatt cactgcttct aaattgctct accgtatgaa attatacaaa
ttattcgttt caatttgttg attactgtgg ctccagatgg ggatgtttac aattattctt tcttgatctg cctcgtcttg
caggtacttc attgttatcg atgacattca aacagaagat cagtggaaaa gcatcaaatc ggcttttccg actgataagg
atattggcag cagaatagtg gtcacgacga ccatccagtc agtagctaat gcctgctgtt ctgcgaatgg gtatttgcac
aaaatgagca ggcttgataa gaactgctca aagcaattgt tgtccaagaa agcttgccca gagaggtatt cacattacaa
gcagccagat tcagcagcaa ttttgaagaa atgtgatggc cagccacttg ctcttgttac cataggtgaa ttcctgcaag
ctaatggctg gccaacgggg cctaactgtg aagatctctg caatcggcta cattatcacc tagagaatga taaaacactt
gaaaggatgc ggcgagtgct ggtccgcaac tacactagtc tacctggcca tgctctcaag gcctgcttac tatattttgg
tatgttccca tctgatcatc caatcaggag gaaaagtctg ttgaggcgat ggctggccga gggatttgta gaaccagtgt
cttcatctag taacctagat tccacggctg ctttcgatgt gctaatggac cggaacatta ttgagcccat caatgtaagc
aataatgata aagtcaagac atgccaaacg tacggtatga tgcgtgaatt catatcgcat atgtcaatct ctcagaactt
tgtcaccttt ttctgtgatg acaagttcct gcccaaatat gttcgtcggc tttctctcca tggtgacact gttgtgaatg
gcgataactt caacggtatt gatttatcac ttgtacggtc tctggtagtc tttggggagg caggtacaac tgtattagac
ttcagcaagt atcaattgct gcgagtttta gatcttgaaa aatgtgatga tttgaacgat gatcatctca aagaaatatg
caatctggtg cttctgaaat atctgagcct tgggggtaat atctccaaac ttccaaagga tattgccaaa ttgaaagatt
tggaggcact cgatgtaagg agatcgaaag taaagataat gccggtagaa gtcttcgggt tgccatgcct aattcatctg
cttggaaaat ttaagctctc agataaagtc aagcagaaga ctgaagtgca agagtttctc tcgaaaggaa aaagcaactt
gcagacgcta gcaggatttg ctagcaacgg aagcgaaggg tttctgcatc ttatgaggta catgaataag ttgagaaagt
tgaagatttg gtgtacgtcg tctgcaggta gcaccgattg gactgatctt agggaggcca ttcaacagtt cattctggat
gaaaaggaag caaatattgg tacccgttct ttatcgcttc atttcactgg atgctctgaa gatgcgataa attccttaaa
agaaccctgc tacctcagct cgttgaaatt acatggcaac ttcccccaat tgcctcagtt tgttacatca cttcgtggtc
tcaaggagct ttgcctttca tctactaaat ttacaacagg ccttcttgaa gccttgagta atttgagcta cttgcagtat
ctcaaactgg ttgccgatga acttgagaag ttcatcataa aagttcaggg gttccccagg ctgctatgcc tttgtattgt
gctacaatgt ccaacattcc cagtaattga agaaggagct ctgccatttc ttgtcacact tcagctgcta tgcaaagatc
tacatggcct ttctgacatc aaaattgaat gttttaaaca tcttcaggag gtaactcttc attctggagt cactccagct
acaagacagg aatgggtaaa ggctgctaag gagcatccga ataggccaaa agtattgctt ctcaaatctg ttgatacagc
agaaagtgaA CATACAGACG TTGATAGTGT AATGGAGGCA GTCAAAAGTG AGACTACAGA ATATTCTATT GCACCAGAGG
GACCAGAACA AGTGATTGAC ATGAACAACA AAATGCAACT TGACCATGGA TTGGAATCCT CTTCTGTGCT GAACAAACAA
AACAATTTTG CAGACCAATC AAGCTCAAAA GATCAACTGC ATTATTCTTT CAACAATATG GGGCTTTCAG ATGTCTCTCC
TGCTGTGAGT GAGCTGCCGA ATGGCATGGT GCCTTCTTGT ACATGACAAG GATCTAGAAT CTTCACGTGG CTTCCCGGTC
AGTTATTTGG ACCTGTTGCT TTCTGATTGT GCATTTTGTG TTTACTTGTC CTTCACACAA TCATCGTCAT CAAAATACCT
TTGATTTCCT ACACTCCCTG TTACCTCCCT TGATGAAATC AGGGGGATTC ATGGGCACAG CTACATGTTC TGTCTGCATT
TTGTATAGTG ACGTGGCATA CCTAGTACTT GTTTTGTCTC CATCCTGTTT GGCAGAGCAA CAGGTTGTAA TAAATCTTGG
TTCTAACTGG CTGCCCTCAG AATATGTTGT CTATAGAATC CACCTGATAG GGAATTCGGC CGTTTGATAA TCCTTTATTT
TTAAGTCTAT TGTTTGTCCT GAG