Os11t0225300-01

Locus

Os11g0225300

Description

Nucleotide binding site-leucine rich repeats (NBS-LRRs) protein, Resistance protein, Resistance to the blast fungus, (Nippponbare: susceptible to the blast fungus carrying the AVR-Pia)

RAP-DB Gene Symbol Synonym(s)

Os11gRGA5, RGA5, Pia

RAP-DB Gene Name Synonym(s)

R-gene analog 5

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Os11gRGA5, RGA5, RGA5-A, RGA5-B, Pi5

Oryzabase Gene Name Synonym(s)

R-gene analog 5

Transcript Evidence

AK072355

AB604629

Protein Evidence

Q2R8L1

Literature

PMID: 23548743

PMID: 21251109

Note

Manual Curation

July 19, 2018

Gene Ontology (GO)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Leucine-rich repeat domain superfamily (IPR032675)

NB-ARC (IPR002182)

Full-length cDNA

J023055L12 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0225300-01)

RiceXPro (AK072355)

Others

Oryzabase (9410)

KEGG (Os11t0225300-01)

Transcript

4236 bp

>Os11t0225300-01 Nucleotide binding site-leucine rich repeats (NBS-LRRs) protein, Resistance protein, Resistance to the blast fungus, (Nippponbare: susceptible to the blast fungus carrying the AVR-Pia)
GGCGGCATGGATGCTCCGGTGAGTTTCTCCCTAGGTGCCATGGGCCCTCTCCTCAGGAAG
CTCGATTCGCTTCCGGTGGCTCCCGAAATCCGGCTGCCTGAGCCACTGAAGGACGGAATC
GAGCTCCTCAAGGAAGATCTAGAAGAAATCGGTGCCGCCCTCGTGGAGCAGTCCATGGTA
GATTCCCCAAGccacagggcaagatactggatggatgaggtgcgtgacctctcctaccac
atcgaggactgcatcgacaccatgttttcgatgcgctgcggcggcgacgacggcaagccc
agatccgttcgccgccacaaggttggccgtgtgaaggttgacggtttctccaagacgcag
aagccgtgcacgaggctcgccaggatcgcggagctcagggctctggtgcgggaggccagc
gagcgccacgaaaggtaccagcttggtgacggccgcgcctcgagctcgagctcgagctct
caccgcgtgttcactgcgcacggccaggttcctgcgccgtgcagaaatctggttggcatg
gacgaaccgaagacgaagctcaccaatatgctcaccgacgaagcagagctgcatatgaaa
gtggtatgcattcttggatcagccggtattggtaagaccacgcttgctgaacaagtatac
cgtaaacttagatggcaattcgattgccatgcttttgtgcgggcatcacgaaaacctgac
atgAGGAGGCTTCTTGGGGCCATCCTCTCTCAAGTTCAGCTGCGTATACGGATATCTGAT
ACCAGCACGGTGCAGAGCCTTATTGATAATCTCTGGGAGTATCTACAGAAAAAGAGgtat
tttattgtaattgatgaattatatgaaacagcaacatgggatatcattaccagtgctttt
ccagaggataataattgcagtaggataatgactacggctggaattgaaggtgtagctctc
gaatgctgcagttatcattctgtcaatattttcaagatgatacctcttggccttgatgat
tctgcaaaattattctttaatagagtttttggatcagagcaacaatgtccttatgaattg
aatgaagtttcatataggattacagcaaaatgtggtggattgccactagcagtcattatt
atagccggtcttttagcaagcctgccgtgcaaaacagagctgtggtacaatatagatgga
tgtttatgttccagtgtgactacagatattgatttggatgagatactgaaggaaatcata
agtcttggctacgacaatcttccacattatttgaagacatgtctgttgtatcttagttta
tattcggagggtttcataatttggacggctgacttactgaagcaatggatatctgaaggt
ttcatcgctgtaatagatggagaagacatagaggaagtcgctgagagctatttctataac
cttgttaacaggggaatgatccaaagtgtgaaaactaagtacaataatcaggtgttgtgt
actgtgcaccacactgtatttgatcttattattcacaagtccaaagaagagaaatttatc
tccgcaatagattactctcaaactatgccaggaaattctttagaggctcgtcgattgtca
ttccactttagcaataccagatatgcaactgaagttgcaggtattacactgtcacaagtt
cgttcgtttgcctttcttggacttctgaagtgtatgccttctattatggaatttaagctt
cttcgggttctaattcttgaattttggggagataaccatggatgcatgagttttaacgtt
gcaagaatttgtagattgtttcagcttagatatttgaagatctcaagccaaatAATAATA
GAATTACCAGCCCAGATCCGGGGGCTAAAATACTTGGAAACACTTGAAATAGATGCAAGA
GTAACTGCGATTCCATCTGATATTATTCATCTCCGAAGTTTGTTGCATCTATATTTTCAA
GATGGGATCGTTCTACCTGATGGCATTGGCTGCATCAGATCTTTGCGTACACTTAAGTAT
TTTGATCTTGGAAGTAACTCTGAAGAGAATATACGGAGTCTTGGTCAGCTGACGAACTTA
CGGGATCTTCATCTCACTTGTTCTGCACCAAAATCTAATCAGCAGGCAAAGAGAAACCTC
GTAATTCTAGCCTCTTATACTGGGAAACTCGGTAACCTCAAATCTGTCAAATTTTCTCCT
GGTGATTCAGGCATGGATATTTCCTTTTTGTTTTATGGAATTGGTATTTCGGTTGATCGT
TCCAGAACAGCGTCCTCTCTTCCTTTCTCTGTTAGGACATTAGAGTTGCCATCCATTTGC
ATATTTGCTAGACTTCCTGACTGGATTGGTCAACTCCGTAAACTCCACACATTGAATCTT
GCTGTTAGAGAACTGATAGAAAATGATATTGATAGTCTTGCAGGACTGCCTGACCTCATT
GTTCTCTCAATGCATATCATGAAAGCTCCTATGGAAAGGATTGTCTTCAACAGAAAAGCA
TTTCCAGTTCTCAAGTATTTCAAGTTTATATGTGGCACACTGCGCATGGCTTTTCAGGCA
GGAGCCATGGCCAATCTTCACAGGCTCAAGCTAGGTTTCAATGCCCATAAAGGGGAGAAG
TATGACAATATTCTTGTAGGCATTGAGCACCTATTAAACCTCAAGAAGATTGCTGTTCGA
ATTGGAGGAGCTGCTGAAGCCAAGGAGTCTGACAGGATGGCTGCAGAGGCTGCGTTGAAA
GAAGCCATTAGAAAGCATCTAATGTTTCTTGATGATCTCGACATAGCAAGGGTAGAATGT
GTTAAGGAAGAGTATAAGTGTATTAAGAAAAAACACAAGATCAAGATTGAAGATTCAATT
AGCGAAAAAAATGGGGACTCAAAAAAGCAGCATTCTGTCGAAAAGAAAGCAGTGTGGGGC
AAAACTATGAAGAATATTGCTGATAGTGGCGTGTTTCCTGAAGATTATACTATGTCAAGG
GAGCAACGGGTCGCAGAAGGCTTCGTAGTGGGCATTGAAAAGTGCAGGGCAGAGGATGCG
GCCGAGCGAATAATCAGGAATGTGCCTGTGGACTATGATGGGCTTGGCCAGGTGAGCACA
TCCAAGATACAGGACCACTTGCCTGAACTTGCTCCTCGTGCTGTGCAAAACGAGAAGTTC
GGCTCTTCAAATGATCTTAGCATAATGATACAAATCAACAAGTATGCTCGTCTGCCATCT
TATGAGTGGAGGGACACTGATATATCCAAACTGAATTTCCGGCTTCTCCGCGCCCCGATG
TTACTTGAAGCTGTAACGGCCCGTTGTCACTTGTTGGACTTAATCCTCATTGGTTCAAAC
AACATTACTGTTCTTGACCTTGGACGTCCCACAATCACCAAACTGCCGGCATCTATAGAA
TGTCTACCTAATTTACGGTACTTGAGGTTGCAGGGCACGCAACTGAAGTCGCTGTCGGAG
GTTATTGTGAAGATGCCCACCATCAGGGGGTTGGACATCAAGAATACCAAGACAGAGGAG
CTACCACAAGGCATTTTGAGGATGAAGAAGTTGAGTCACCTGAGTATGGGGGAGAAGCAG
AAAAATATTCAAGTATTCATGGAAAAAATGCAGACTCTGGCTGAGACCGTCCAAGACAGC
GATGACTTGTCCGACGAAACAGAGGGAATAGCCGACGACGAAGGCGAGTTCTCTACAAGG
GCCAACGCGTCAACACCGAAGGTGGATGAGGACGAGGTGGACCGGAGGGCCAATAACTTC
ATCGCCAGGTTCAGGAAGCAGATCACGATCAGGAATTCAGGATTCGCCAAAAAGGAGAGC
AGCATCGACGAACGACTGTGGATACGAGATCTCGATGAGTGCCAACTCTCCAAGAGAGGT
GGACGATTTTAAGAAGAAGTTCGACGAGATCATTGCCAGGAACAGGCACACATGGAAGCC
AATCGAGTCACCGCGTTCTGTCAAGCACGGCAAGTATTTCGTTCGCTGCCCGCCGTCGCT
AATCACCAGCGCTGTCTTTTCCTTTTTCTTTCTTTCTATTTTTCTAGTATGGTACTCCCT
CCGTTTCAGGATATtgtcaggaaacccctaatcaatcgccttgtgaacactggatgaact
cacgcgaaagtggaagaacacgtagaacacaatagtgtagacgaacagacaacaaaaaca
gagtttttggtgctgcctgaattgcttgcagctttt

CDS

3906 bp

>Os11t0225300-01 Nucleotide binding site-leucine rich repeats (NBS-LRRs) protein, Resistance protein, Resistance to the blast fungus, (Nippponbare: susceptible to the blast fungus carrying the AVR-Pia)
ATGGATGCTCCGGTGAGTTTCTCCCTAGGTGCCATGGGCCCTCTCCTCAGGAAGCTCGAT
TCGCTTCCGGTGGCTCCCGAAATCCGGCTGCCTGAGCCACTGAAGGACGGAATCGAGCTC
CTCAAGGAAGATCTAGAAGAAATCGGTGCCGCCCTCGTGGAGCAGTCCATGGTAGATTCC
CCAAGccacagggcaagatactggatggatgaggtgcgtgacctctcctaccacatcgag
gactgcatcgacaccatgttttcgatgcgctgcggcggcgacgacggcaagcccagatcc
gttcgccgccacaaggttggccgtgtgaaggttgacggtttctccaagacgcagaagccg
tgcacgaggctcgccaggatcgcggagctcagggctctggtgcgggaggccagcgagcgc
cacgaaaggtaccagcttggtgacggccgcgcctcgagctcgagctcgagctctcaccgc
gtgttcactgcgcacggccaggttcctgcgccgtgcagaaatctggttggcatggacgaa
ccgaagacgaagctcaccaatatgctcaccgacgaagcagagctgcatatgaaagtggta
tgcattcttggatcagccggtattggtaagaccacgcttgctgaacaagtataccgtaaa
cttagatggcaattcgattgccatgcttttgtgcgggcatcacgaaaacctgacatgAGG
AGGCTTCTTGGGGCCATCCTCTCTCAAGTTCAGCTGCGTATACGGATATCTGATACCAGC
ACGGTGCAGAGCCTTATTGATAATCTCTGGGAGTATCTACAGAAAAAGAGgtattttatt
gtaattgatgaattatatgaaacagcaacatgggatatcattaccagtgcttttccagag
gataataattgcagtaggataatgactacggctggaattgaaggtgtagctctcgaatgc
tgcagttatcattctgtcaatattttcaagatgatacctcttggccttgatgattctgca
aaattattctttaatagagtttttggatcagagcaacaatgtccttatgaattgaatgaa
gtttcatataggattacagcaaaatgtggtggattgccactagcagtcattattatagcc
ggtcttttagcaagcctgccgtgcaaaacagagctgtggtacaatatagatggatgttta
tgttccagtgtgactacagatattgatttggatgagatactgaaggaaatcataagtctt
ggctacgacaatcttccacattatttgaagacatgtctgttgtatcttagtttatattcg
gagggtttcataatttggacggctgacttactgaagcaatggatatctgaaggtttcatc
gctgtaatagatggagaagacatagaggaagtcgctgagagctatttctataaccttgtt
aacaggggaatgatccaaagtgtgaaaactaagtacaataatcaggtgttgtgtactgtg
caccacactgtatttgatcttattattcacaagtccaaagaagagaaatttatctccgca
atagattactctcaaactatgccaggaaattctttagaggctcgtcgattgtcattccac
tttagcaataccagatatgcaactgaagttgcaggtattacactgtcacaagttcgttcg
tttgcctttcttggacttctgaagtgtatgccttctattatggaatttaagcttcttcgg
gttctaattcttgaattttggggagataaccatggatgcatgagttttaacgttgcaaga
atttgtagattgtttcagcttagatatttgaagatctcaagccaaatAATAATAGAATTA
CCAGCCCAGATCCGGGGGCTAAAATACTTGGAAACACTTGAAATAGATGCAAGAGTAACT
GCGATTCCATCTGATATTATTCATCTCCGAAGTTTGTTGCATCTATATTTTCAAGATGGG
ATCGTTCTACCTGATGGCATTGGCTGCATCAGATCTTTGCGTACACTTAAGTATTTTGAT
CTTGGAAGTAACTCTGAAGAGAATATACGGAGTCTTGGTCAGCTGACGAACTTACGGGAT
CTTCATCTCACTTGTTCTGCACCAAAATCTAATCAGCAGGCAAAGAGAAACCTCGTAATT
CTAGCCTCTTATACTGGGAAACTCGGTAACCTCAAATCTGTCAAATTTTCTCCTGGTGAT
TCAGGCATGGATATTTCCTTTTTGTTTTATGGAATTGGTATTTCGGTTGATCGTTCCAGA
ACAGCGTCCTCTCTTCCTTTCTCTGTTAGGACATTAGAGTTGCCATCCATTTGCATATTT
GCTAGACTTCCTGACTGGATTGGTCAACTCCGTAAACTCCACACATTGAATCTTGCTGTT
AGAGAACTGATAGAAAATGATATTGATAGTCTTGCAGGACTGCCTGACCTCATTGTTCTC
TCAATGCATATCATGAAAGCTCCTATGGAAAGGATTGTCTTCAACAGAAAAGCATTTCCA
GTTCTCAAGTATTTCAAGTTTATATGTGGCACACTGCGCATGGCTTTTCAGGCAGGAGCC
ATGGCCAATCTTCACAGGCTCAAGCTAGGTTTCAATGCCCATAAAGGGGAGAAGTATGAC
AATATTCTTGTAGGCATTGAGCACCTATTAAACCTCAAGAAGATTGCTGTTCGAATTGGA
GGAGCTGCTGAAGCCAAGGAGTCTGACAGGATGGCTGCAGAGGCTGCGTTGAAAGAAGCC
ATTAGAAAGCATCTAATGTTTCTTGATGATCTCGACATAGCAAGGGTAGAATGTGTTAAG
GAAGAGTATAAGTGTATTAAGAAAAAACACAAGATCAAGATTGAAGATTCAATTAGCGAA
AAAAATGGGGACTCAAAAAAGCAGCATTCTGTCGAAAAGAAAGCAGTGTGGGGCAAAACT
ATGAAGAATATTGCTGATAGTGGCGTGTTTCCTGAAGATTATACTATGTCAAGGGAGCAA
CGGGTCGCAGAAGGCTTCGTAGTGGGCATTGAAAAGTGCAGGGCAGAGGATGCGGCCGAG
CGAATAATCAGGAATGTGCCTGTGGACTATGATGGGCTTGGCCAGGTGAGCACATCCAAG
ATACAGGACCACTTGCCTGAACTTGCTCCTCGTGCTGTGCAAAACGAGAAGTTCGGCTCT
TCAAATGATCTTAGCATAATGATACAAATCAACAAGTATGCTCGTCTGCCATCTTATGAG
TGGAGGGACACTGATATATCCAAACTGAATTTCCGGCTTCTCCGCGCCCCGATGTTACTT
GAAGCTGTAACGGCCCGTTGTCACTTGTTGGACTTAATCCTCATTGGTTCAAACAACATT
ACTGTTCTTGACCTTGGACGTCCCACAATCACCAAACTGCCGGCATCTATAGAATGTCTA
CCTAATTTACGGTACTTGAGGTTGCAGGGCACGCAACTGAAGTCGCTGTCGGAGGTTATT
GTGAAGATGCCCACCATCAGGGGGTTGGACATCAAGAATACCAAGACAGAGGAGCTACCA
CAAGGCATTTTGAGGATGAAGAAGTTGAGTCACCTGAGTATGGGGGAGAAGCAGAAAAAT
ATTCAAGTATTCATGGAAAAAATGCAGACTCTGGCTGAGACCGTCCAAGACAGCGATGAC
TTGTCCGACGAAACAGAGGGAATAGCCGACGACGAAGGCGAGTTCTCTACAAGGGCCAAC
GCGTCAACACCGAAGGTGGATGAGGACGAGGTGGACCGGAGGGCCAATAACTTCATCGCC
AGGTTCAGGAAGCAGATCACGATCAGGAATTCAGGATTCGCCAAAAAGGAGAGCAGCATC
GACGAACGACTGTGGATACGAGATCTCGATGAGTGCCAACTCTCCAAGAGAGGTGGACGA
TTTTAA

Protein

1302 aa

>Os11t0225300-01 Nucleotide binding site-leucine rich repeats (NBS-LRRs) protein, Resistance protein, Resistance to the blast fungus, (Nippponbare: susceptible to the blast fungus carrying the AVR-Pia)
MDAPVSFSLGAMGPLLRKLDSLPVAPEIRLPEPLKDGIELLKEDLEEIGAALVEQSMVDS
PSHRARYWMDEVRDLSYHIEDCIDTMFSMRCGGDDGKPRSVRRHKVGRVKVDGFSKTQKP
CTRLARIAELRALVREASERHERYQLGDGRASSSSSSSHRVFTAHGQVPAPCRNLVGMDE
PKTKLTNMLTDEAELHMKVVCILGSAGIGKTTLAEQVYRKLRWQFDCHAFVRASRKPDMR
RLLGAILSQVQLRIRISDTSTVQSLIDNLWEYLQKKRYFIVIDELYETATWDIITSAFPE
DNNCSRIMTTAGIEGVALECCSYHSVNIFKMIPLGLDDSAKLFFNRVFGSEQQCPYELNE
VSYRITAKCGGLPLAVIIIAGLLASLPCKTELWYNIDGCLCSSVTTDIDLDEILKEIISL
GYDNLPHYLKTCLLYLSLYSEGFIIWTADLLKQWISEGFIAVIDGEDIEEVAESYFYNLV
NRGMIQSVKTKYNNQVLCTVHHTVFDLIIHKSKEEKFISAIDYSQTMPGNSLEARRLSFH
FSNTRYATEVAGITLSQVRSFAFLGLLKCMPSIMEFKLLRVLILEFWGDNHGCMSFNVAR
ICRLFQLRYLKISSQIIIELPAQIRGLKYLETLEIDARVTAIPSDIIHLRSLLHLYFQDG
IVLPDGIGCIRSLRTLKYFDLGSNSEENIRSLGQLTNLRDLHLTCSAPKSNQQAKRNLVI
LASYTGKLGNLKSVKFSPGDSGMDISFLFYGIGISVDRSRTASSLPFSVRTLELPSICIF
ARLPDWIGQLRKLHTLNLAVRELIENDIDSLAGLPDLIVLSMHIMKAPMERIVFNRKAFP
VLKYFKFICGTLRMAFQAGAMANLHRLKLGFNAHKGEKYDNILVGIEHLLNLKKIAVRIG
GAAEAKESDRMAAEAALKEAIRKHLMFLDDLDIARVECVKEEYKCIKKKHKIKIEDSISE
KNGDSKKQHSVEKKAVWGKTMKNIADSGVFPEDYTMSREQRVAEGFVVGIEKCRAEDAAE
RIIRNVPVDYDGLGQVSTSKIQDHLPELAPRAVQNEKFGSSNDLSIMIQINKYARLPSYE
WRDTDISKLNFRLLRAPMLLEAVTARCHLLDLILIGSNNITVLDLGRPTITKLPASIECL
PNLRYLRLQGTQLKSLSEVIVKMPTIRGLDIKNTKTEELPQGILRMKKLSHLSMGEKQKN
IQVFMEKMQTLAETVQDSDDLSDETEGIADDEGEFSTRANASTPKVDEDEVDRRANNFIA
RFRKQITIRNSGFAKKESSIDERLWIRDLDECQLSKRGGRF*

5'UTR

chr11:6554522..6554527 (+ strand) : 6 bp

CDS

chr11:6554528..6555357 (+ strand) : 830 bp

chr11:6556476..6558608 (+ strand) : 2133 bp

chr11:6560421..6561363 (+ strand) : 943 bp

3'UTR

chr11:6561364..6561687 (+ strand) : 324 bp

FASTA

>Os11t0225300-01 class=Sequence position=chr11:6554522..6561687 (+ strand)
GGCGGCATGG ATGCTCCGGT GAGTTTCTCC CTAGGTGCCA TGGGCCCTCT CCTCAGGAAG CTCGATTCGC TTCCGGTGGC
TCCCGAAATC CGGCTGCCTG AGCCACTGAA GGACGGAATC GAGCTCCTCA AGGAAGATCT AGAAGAAATC GGTGCCGCCC
TCGTGGAGCA GTCCATGGTA GATTCCCCAA Gccacagggc aagatactgg atggatgagg tgcgtgacct ctcctaccac
atcgaggact gcatcgacac catgttttcg atgcgctgcg gcggcgacga cggcaagccc agatccgttc gccgccacaa
ggttggccgt gtgaaggttg acggtttctc caagacgcag aagccgtgca cgaggctcgc caggatcgcg gagctcaggg
ctctggtgcg ggaggccagc gagcgccacg aaaggtacca gcttggtgac ggccgcgcct cgagctcgag ctcgagctct
caccgcgtgt tcactgcgca cggccaggtt cctgcgccgt gcagaaatct ggttggcatg gacgaaccga agacgaagct
caccaatatg ctcaccgacg aagcagagct gcatatgaaa gtggtatgca ttcttggatc agccggtatt ggtaagacca
cgcttgctga acaagtatac cgtaaactta gatggcaatt cgattgccat gcttttgtgc gggcatcacg aaaacctgac
atgAGGAGGC TTCTTGGGGC CATCCTCTCT CAAGTTCAGC TGCGTATACG GATATCTGAT ACCAGCACGG TGCAGAGCCT
TATTGATAAT CTCTGGGAGT ATCTACAGAA AAAGAGGTAA TTAATTAACG CTATATTCAC TGCTTTTTAA TACTAGTTCA
GCTACTGAGC ATCACCAATA GACTCTCAAA ATTCTATTCC CAAAAATCTG TTATTGGGCG TTCTAAACTG ATTTTGGGGT
GTTGAATGTA TTCCTCCTTC CAACAAATTG GCTTAATTAA CTGCCTAAAA TTAAGGACTT GGCCCATGTA AAAACTATTA
ACAGAAATCA TGCTCCCCAT CATCCATCAT CCAGCGTGAT CACATCTGCA TGATCGGCCA CGCCTCCCTC CGCGATCACT
CCCGCCATGA TTTTGGGAGT CAACCCTCTC CCCTAGAAGA GTAGAGCAAG ACATACGGGA ATGGGAGCTG CAAAATTTTG
GTAGACCTTT CGGATATTGT TGGAGCAAGA TTTTTACAAA AAAAATTGTA AATTTTGGTA TTGGGAATGA TTTTGGGAGA
CTCTTGTGAg gctatctcca acccttcatg tcattagcat gaggggactc agtgtccata gcattaagta tattgtcaca
tcggaaaaaa tctgaggtgg caagagagtt aatgaggaga gagatgaaaa gatgaagaaa ccatctcttc acaacaacca
agaatgaaaa caagtgatag gttcataaaa ggagagagaa gaaagatgat tggatatata gtgtctatat gacatagcaa
gtatggaaac tactttgata gtttctaggt tggggatggc cTGATGCTGC ACATTGAACA ATTGCTGTtc cctccgtcac
attgaataag gcgcgcatgc attttaaaat tgaactctct aaatatctga tcaataatat tttgttataa attaactttt
atttgacaaa aataatatca ttggattgac atttaaattt actttgatat aattgtgatt ttgttgttac aaatatcata
gtattttaga tattcaaaat caaagatttg ttttaaaaac cataccaagt ttgacTGCGC CGGATAAAGG GGGTAATTTA
GAAAATAAAT AAATAAATAA ATATATTATC CTGATAAACT TCCTTTCCTT TTTGAGAGAG ACCTGATACA CTTTGTTCTT
TTCCCAGAGA ATATAATTTA ATTATACTTT Gcaggtattt tattgtaatt gatgaattat atgaaacagc aacatgggat
atcattacca gtgcttttcc agaggataat aattgcagta ggataatgac tacggctgga attgaaggtg tagctctcga
atgctgcagt tatcattctg tcaatatttt caagatgata cctcttggcc ttgatgattc tgcaaaatta ttctttaata
gagtttttgg atcagagcaa caatgtcctt atgaattgaa tgaagtttca tataggatta cagcaaaatg tggtggattg
ccactagcag tcattattat agccggtctt ttagcaagcc tgccgtgcaa aacagagctg tggtacaata tagatggatg
tttatgttcc agtgtgacta cagatattga tttggatgag atactgaagg aaatcataag tcttggctac gacaatcttc
cacattattt gaagacatgt ctgttgtatc ttagtttata ttcggagggt ttcataattt ggacggctga cttactgaag
caatggatat ctgaaggttt catcgctgta atagatggag aagacataga ggaagtcgct gagagctatt tctataacct
tgttaacagg ggaatgatcc aaagtgtgaa aactaagtac aataatcagg tgttgtgtac tgtgcaccac actgtatttg
atcttattat tcacaagtcc aaagaagaga aatttatctc cgcaatagat tactctcaaa ctatgccagg aaattcttta
gaggctcgtc gattgtcatt ccactttagc aataccagat atgcaactga agttgcaggt attacactgt cacaagttcg
ttcgtttgcc tttcttggac ttctgaagtg tatgccttct attatggaat ttaagcttct tcgggttcta attcttgaat
tttggggaga taaccatgga tgcatgagtt ttaacgttgc aagaatttgt agattgtttc agcttagata tttgaagatc
tcaagccaaa tAATAATAGA ATTACCAGCC CAGATCCGGG GGCTAAAATA CTTGGAAACA CTTGAAATAG ATGCAAGAGT
AACTGCGATT CCATCTGATA TTATTCATCT CCGAAGTTTG TTGCATCTAT ATTTTCAAGA TGGGATCGTT CTACCTGATG
GCATTGGCTG CATCAGATCT TTGCGTACAC TTAAGTATTT TGATCTTGGA AGTAACTCTG AAGAGAATAT ACGGAGTCTT
GGTCAGCTGA CGAACTTACG GGATCTTCAT CTCACTTGTT CTGCACCAAA ATCTAATCAG CAGGCAAAGA GAAACCTCGT
AATTCTAGCC TCTTATACTG GGAAACTCGG TAACCTCAAA TCTGTCAAAT TTTCTCCTGG TGATTCAGGC ATGGATATTT
CCTTTTTGTT TTATGGAATT GGTATTTCGG TTGATCGTTC CAGAACAGCG TCCTCTCTTC CTTTCTCTGT TAGGACATTA
GAGTTGCCAT CCATTTGCAT ATTTGCTAGA CTTCCTGACT GGATTGGTCA ACTCCGTAAA CTCCACACAT TGAATCTTGC
TGTTAGAGAA CTGATAGAAA ATGATATTGA TAGTCTTGCA GGACTGCCTG ACCTCATTGT TCTCTCAATG CATATCATGA
AAGCTCCTAT GGAAAGGATT GTCTTCAACA GAAAAGCATT TCCAGTTCTC AAGTATTTCA AGTTTATATG TGGCACACTG
CGCATGGCTT TTCAGGCAGG AGCCATGGCC AATCTTCACA GGCTCAAGCT AGGTTTCAAT GCCCATAAAG GGGAGAAGTA
TGACAATATT CTTGTAGGCA TTGAGCACCT ATTAAACCTC AAGAAGATTG CTGTTCGAAT TGGAGGAGCT GCTGAAGCCA
AGGAGTCTGA CAGGATGGCT GCAGAGGCTG CGTTGAAAGA AGCCATTAGA AAGCATCTAA TGTTTCTTGA TGATCTCGAC
ATAGCAAGGG TAGAATGTGT TAAGGAAGAG TATAAGTGTA TTAAGAAAAA ACACAAGATC AAGATTGAAG ATTCAATTAG
CGAAAAAAAT GGGGACTCAA AAAAGCAGCA TTCTGTCGAA AAGAAAGCAG TGTGGGGCAA AACTATGAAG AATATTGCTG
ATAGTGGGTA TGTTCTTTCC TATTATTTCA GCCTCTACAT TTTCCAATAT ATATTGTTTA GAAATAAATG ATTACTACAA
CAATAACCTT ATAGTAAAAC GCTAAAACAC AGTTGTATCA AAAGGAATCT TTACAAAGGT ACATCTATGC TCTTTGAAAA
GGATAAGATG GGATGCTCTA TACTAATTGG AGCCTCTACT AGAAGCTTTC ACATTAACCT TAGAAGGCAA AAGACTGGAA
ATTCCCACAT TAACAAAAAA GAAAACTAAA AGCATTAATC TTTGAAAGAT CAAATGGTAT GCGCCAATGT ATCAAATCTA
AGGTTGATAT CTTCCACCAC AGAATATGTG CATTTATCAA ATTTGGAATC AATAAATACC TAGTTATACT TGGTTTGGAC
ACTCGAGTAT AGTATTTTGA TGAATAATAA TTGAAACATT CAGCATTAAC AAATATTGAG TTTTACTCGG TCTAGAGTCT
CACTAGCTTA TTTTTTATGA TTTTATTTTA TAATTCCGAA ATTCAGAATT GATAAATACT GTGTTGTACT AGGTTTGAAG
TTTTTGTTGA ATAATAGTTT CAAAATTCAA AAACAATAAA TATGCTCAAT TTAGAGCGTA GAGTAATTTT CTCATGACCT
AATAATTCTG CAGTTTAGAT TTAATCATAG TATCTCATGA TTTGATAATT CAAAAATCGA AATTAATACA TACTCAGTTG
ATGCTTGTAC ATTCACACGG GTTAATTTCT ACCGGTGTCC AAGCGGTGTA GCAAGATCAA ATAGTATGGG TTAGACTCAA
TTTACACTTT GTAGTCAAAG TTGTGTGACC TTGTAAGCAA TCTAGACAAA TGGCAAATCT ATGGCTATCT AAAATTTAAA
ACAAATCAGA CATGCTATTT ACGGGAAGCT GTTTTGATCC CTCAAGAGAA TGTCCCTCGC TTGTAAAAAA AAACCatcta
gaattctcaa aaaaaattca caacattcat actatgtatg tatgtatgta tgcatgcatg catgcatgca cacacacaca
catgtatgta catataacac atatacatat acatatacat attcatacat aacgcacaca cacaaattaa cttaaatttt
tgaaaatttt caacttatga gtatatacta aggtacaaga atttgattcg tacctatatc tagcaacaaa acaactcaaa
ttcaacttta ttttacaatc cattattaca tacctaacta attatatgtt tgggtggtat atacctagaa gcaaaatcta
acaaaaaaat gttcaaattt agttcaaact tgttagtaaa gaagttaatg tccatacctG ATCTACATTG CCTTGCTCTC
ATCATCGTCA GCGTTGTGGC CTTTCTCACA GGCAACCTCT CCTCGCTCGA GATCCATAAA AACAAGAGAG AAAAAAATGG
ATTGGTTAGT TCGTGTGTGT ATCTATATAT AGGTCTATAG TAAAAAAATT ACTGGGTGAT GCGTTGTGGG ATGGGCGATG
CTGGTAGTCT GCGGGGGTGG GTTTACACAC ACAACactcc actaggtcca aactcaattt ataacattta ggtataaaaa
ataaatatat tcataccgga atttgtcttt ttgtttctca atatataggt cgaatttgaa gttgttctct cgtggaatgt
tagatgtcac tgtactccac attgttaatt aaatttttat aactatttta attgaattta aaagcaaaaa agtatatgag
gggatatcct ttcgtgggat tagaattcat tccTGCTATT AACTAGACCT GTATTGCAGC GTGTTTCCTG AAGATTATAC
TATGTCAAGG GAGCAACGGG TCGCAGAAGG CTTCGTAGTG GGCATTGAAA AGTGCAGGGC AGAGGATGCG GCCGAGCGAA
TAATCAGGAA TGTGCCTGTG GACTATGATG GGCTTGGCCA GGTGAGCACA TCCAAGATAC AGGACCACTT GCCTGAACTT
GCTCCTCGTG CTGTGCAAAA CGAGAAGTTC GGCTCTTCAA ATGATCTTAG CATAATGATA CAAATCAACA AGTATGCTCG
TCTGCCATCT TATGAGTGGA GGGACACTGA TATATCCAAA CTGAATTTCC GGCTTCTCCG CGCCCCGATG TTACTTGAAG
CTGTAACGGC CCGTTGTCAC TTGTTGGACT TAATCCTCAT TGGTTCAAAC AACATTACTG TTCTTGACCT TGGACGTCCC
ACAATCACCA AACTGCCGGC ATCTATAGAA TGTCTACCTA ATTTACGGTA CTTGAGGTTG CAGGGCACGC AACTGAAGTC
GCTGTCGGAG GTTATTGTGA AGATGCCCAC CATCAGGGGG TTGGACATCA AGAATACCAA GACAGAGGAG CTACCACAAG
GCATTTTGAG GATGAAGAAG TTGAGTCACC TGAGTATGGG GGAGAAGCAG AAAAATATTC AAGTATTCAT GGAAAAAATG
CAGACTCTGG CTGAGACCGT CCAAGACAGC GATGACTTGT CCGACGAAAC AGAGGGAATA GCCGACGACG AAGGCGAGTT
CTCTACAAGG GCCAACGCGT CAACACCGAA GGTGGATGAG GACGAGGTGG ACCGGAGGGC CAATAACTTC ATCGCCAGGT
TCAGGAAGCA GATCACGATC AGGAATTCAG GATTCGCCAA AAAGGAGAGC AGCATCGACG AACGACTGTG GATACGAGAT
CTCGATGAGT GCCAACTCTC CAAGAGAGGT GGACGATTTT AAGAAGAAGT TCGACGAGAT CATTGCCAGG AACAGGCACA
CATGGAAGCC AATCGAGTCA CCGCGTTCTG TCAAGCACGG CAAGTATTTC GTTCGCTGCC CGCCGTCGCT AATCACCAGC
GCTGTCTTTT CCTTTTTCTT TCTTTCTATT TTTCTAGTAT GGTACTCCCT CCGTTTCAGG ATATtgtcag gaaaccccta
atcaatcgcc ttgtgaacac tggatgaact cacgcgaaag tggaagaaca cgtagaacac aatagtgtag acgaacagac
aacaaaaaca gagtttttgg tgctgcctga attgcttgca gctttt