Os11t0225300-02

Locus

Os11g0225300

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Os11gRGA5, RGA5, RGA5-A, RGA5-B, Pi5

Oryzabase Gene Name Synonym(s)

R-gene analog 5

Transcript Evidence

AK111306 (DDBJ, Best hit)

Protein Evidence

A2ZCS7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

NB-ARC (IPR002182)

Full-length cDNA

002-181-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0225300-02)

RiceXPro (AK111306)

Others

Oryzabase (9410)

KEGG (Os11t0225300-02)

Transcript

864 bp

>Os11t0225300-02 Hypothetical conserved gene.
AGGTGCCATGGGCCCTCTCCTCAGGAAGCTCGATTCGCTTCCGGTGGCTCCCGAAATCCG
GCTGCCTGAGCCACTGAAGGACGGAATCGAGCTCCTCAAGGAAGATCTAGAAGAAATCGG
TGCCGCCCTCGTGGAGCAGTCCATGGTAGATTCCCCAAGccacagggcaagatactggat
ggatgaggtgcgtgacctctcctaccacatcgaggactgcatcgacaccatgttttcgat
gcgctgcggcggcgacgacggcaagcccagatccgttcgccgccacaaggttggccgtgt
gaaggttgacggtttctccaagacgcagaagccgtgcacgaggctcgccaggatcgcgga
gctcagggctctggtgcgggaggccagcgagcgccacgaaaggtaccagcttggtgacgg
ccgcgcctcgagctcgagctcgagctctcaccgcgtgttcactgcgcacggccaggttcc
tgcgccgtgcagaaatctggttggcatggacgaaccgaagacgaagctcaccaatatgct
caccgacgaagcagagctgcatatgaaagtggtatgcattcttggatcagccggtattgg
taagaccacgcttgctgaacaagtataccgtaaacttagatggcaattcgattgccatgc
ttttgtgcgggcatcacgaaaacctgacatgAGGAGGCTTCTTGGGGCCATCCTCTCTCA
AGTTCAGCTGCGTATACGGATATCTGATACCAGCACGGTGCAGAGCCTTATTGATAATCT
CTGGGAGTATCTACAGAAAAAGAGGTAATTAATTAACGCTATATTCACTGCTTTTTAATA
CTAGTTCAGCTACTGAGCATCACC

CDS

807 bp

>Os11t0225300-02 Hypothetical conserved gene.
GGTGCCATGGGCCCTCTCCTCAGGAAGCTCGATTCGCTTCCGGTGGCTCCCGAAATCCGG
CTGCCTGAGCCACTGAAGGACGGAATCGAGCTCCTCAAGGAAGATCTAGAAGAAATCGGT
GCCGCCCTCGTGGAGCAGTCCATGGTAGATTCCCCAAGccacagggcaagatactggatg
gatgaggtgcgtgacctctcctaccacatcgaggactgcatcgacaccatgttttcgatg
cgctgcggcggcgacgacggcaagcccagatccgttcgccgccacaaggttggccgtgtg
aaggttgacggtttctccaagacgcagaagccgtgcacgaggctcgccaggatcgcggag
ctcagggctctggtgcgggaggccagcgagcgccacgaaaggtaccagcttggtgacggc
cgcgcctcgagctcgagctcgagctctcaccgcgtgttcactgcgcacggccaggttcct
gcgccgtgcagaaatctggttggcatggacgaaccgaagacgaagctcaccaatatgctc
accgacgaagcagagctgcatatgaaagtggtatgcattcttggatcagccggtattggt
aagaccacgcttgctgaacaagtataccgtaaacttagatggcaattcgattgccatgct
tttgtgcgggcatcacgaaaacctgacatgAGGAGGCTTCTTGGGGCCATCCTCTCTCAA
GTTCAGCTGCGTATACGGATATCTGATACCAGCACGGTGCAGAGCCTTATTGATAATCTC
TGGGAGTATCTACAGAAAAAGAGGTAA

Protein

269 aa

>Os11t0225300-02 Hypothetical conserved gene.
GAMGPLLRKLDSLPVAPEIRLPEPLKDGIELLKEDLEEIGAALVEQSMVDSPSHRARYWM
DEVRDLSYHIEDCIDTMFSMRCGGDDGKPRSVRRHKVGRVKVDGFSKTQKPCTRLARIAE
LRALVREASERHERYQLGDGRASSSSSSSHRVFTAHGQVPAPCRNLVGMDEPKTKLTNML
TDEAELHMKVVCILGSAGIGKTTLAEQVYRKLRWQFDCHAFVRASRKPDMRRLLGAILSQ
VQLRIRISDTSTVQSLIDNLWEYLQKKR*

5'UTR

chr11:6554554..6554554 (+ strand) : 1 bp

CDS

chr11:6554555..6555361 (+ strand) : 807 bp

3'UTR

chr11:6555362..6555417 (+ strand) : 56 bp

FASTA

>Os11t0225300-02 class=Sequence position=chr11:6554554..6555417 (+ strand)
AGGTGCCATG GGCCCTCTCC TCAGGAAGCT CGATTCGCTT CCGGTGGCTC CCGAAATCCG GCTGCCTGAG CCACTGAAGG
ACGGAATCGA GCTCCTCAAG GAAGATCTAG AAGAAATCGG TGCCGCCCTC GTGGAGCAGT CCATGGTAGA TTCCCCAAGc
cacagggcaa gatactggat ggatgaggtg cgtgacctct cctaccacat cgaggactgc atcgacacca tgttttcgat
gcgctgcggc ggcgacgacg gcaagcccag atccgttcgc cgccacaagg ttggccgtgt gaaggttgac ggtttctcca
agacgcagaa gccgtgcacg aggctcgcca ggatcgcgga gctcagggct ctggtgcggg aggccagcga gcgccacgaa
aggtaccagc ttggtgacgg ccgcgcctcg agctcgagct cgagctctca ccgcgtgttc actgcgcacg gccaggttcc
tgcgccgtgc agaaatctgg ttggcatgga cgaaccgaag acgaagctca ccaatatgct caccgacgaa gcagagctgc
atatgaaagt ggtatgcatt cttggatcag ccggtattgg taagaccacg cttgctgaac aagtataccg taaacttaga
tggcaattcg attgccatgc ttttgtgcgg gcatcacgaa aacctgacat gAGGAGGCTT CTTGGGGCCA TCCTCTCTCA
AGTTCAGCTG CGTATACGGA TATCTGATAC CAGCACGGTG CAGAGCCTTA TTGATAATCT CTGGGAGTAT CTACAGAAAA
AGAGGTAATT AATTAACGCT ATATTCACTG CTTTTTAATA CTAGTTCAGC TACTGAGCAT CACC