Os11t0264300-01

Locus

Os11g0264300

Description

Similar to RWP-RK domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

OsNIN-like4, OsNIN-like 4, NIN-like4, NIN-like 4

Transcript Evidence

AK110967 (DDBJ, Best hit)

Protein Evidence

Q2R7K6 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

002-174-B07 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0264300-01)

RiceXPro (AK110967)

Others

Oryzabase (21543)

KEGG (Os11t0264300-01)

Transcript

1552 bp

>Os11t0264300-01 Similar to RWP-RK domain containing protein, expressed.
TCCCTATTCCATTCCCTTTTCTCCTCCTCCTCCTCCTCCTCACCGCCGGCGGCGAGCGGC
CGGCCGGCGAGCAGAGCAGAGCAGAGGAGAGAGCCGACCTCCATCTGGGCTCCAATCGAA
GCTGAAGCGCCTCGTCGTAGTTTGGGCAAAAGAAGTTTTGATTTTTTTTATTTATTTTGG
GTGCTGAGGAAGAGTGTAATTAAGCTGTGAGGATTGAGAAGATGGATGGAGGTGGGACGC
CGGATGGGGATCCGGTGCCGGACATGGACATGCTCATGCTGTCATCAGCGCTCGATGGCC
TCGACAGCTACACCGACCTCGTCGCGGGTTCATCGGTAGCCGACAGCATCTTCTCAGCTC
TTACCTGTTTCCCACCATCACAAGAACGATTGCTGCACGTCTCGACTCCTGTGGGTTCTA
ATTCTAGGCAAGATGATTCTGATGTTTCCATCACTAAGGAGGGTACAACAACAAGAAGAG
GTGATTGCGCCGCCGGATTAGCTTCAGGTGAGCCGGTGGCCGCGGGAATTGGCTCTGTCC
CGAAGCCGTTCGACGGCGTCACACTGACGGAGAGGATGCTCAGGGCGCTTGCGATGCTCA
AAGAGGCGTCGGGTGGCGAAGCGATCCTTGTGCAGGTCTGGATGCCTGTGAGGAATGGGG
AGCAGCATGTGCTGACTACCTCTGACCAGCCGTTCTTGCTCGATCAGAAGCTTACGGGAT
ACAGGGAAGTCTCCAGGCAGTTCACATTCTCGGCTGAAGAAGGACCCGGTCTGTTCCCCG
GATTGCCCGGCCGGGTTTTCATGTCCGGCATGCCAGAGTGGACGTCGAATGTGATGTACT
ATCATGGCTCGGAGTATTTGAGGGTTGATTATGCTAGGCGCCACGAGGTCCGTGGATCCC
TTGCGATGCCGGTTTTCAACTCAAGTGGTGGGTCTTGCTGTGCAGTGTTAGAAGTAGTAA
TGACACGAGAGAAGGATAACTTTTGCTTAGAGATGGTCAATGTTTCGAATGCTCTGCAGG
GCACACATGACTTGAACACACAGCACAGAAAGAATGACTAACATCAGATGGACACCTTAC
AAACACAATTTCAGTCAATGCCTAGGGTCAGTCGGGAAGACAAGCTGAGTTTCTTGTCCT
TTATATCACCCACAAACACAAGCCACCCCCAATCATCCAGAACTAGTTGGAATTTGGAAA
CCGGGCAATCCATCCAATCCCAAATATCCCCAATTGAGGTAGGTGATCTAGCATGATGTA
TGCTCAACTGACCATGAACTTTGCTAGCACACATTTTCAAAATGTTTCTCAGGACACTCA
CCGAACTTGCAATTCTGGGAACTCTTCTAACATGAGTTATCTTTAGTCAAAATATTTCTG
CACAGCAGCCACGAGTTTTTTTTTTCCTCTAAGGCTGGTTGCTTAGTCTCCCAGCAGATG
TAAAGAATAAAGACGGCCATATACATAGCTTTTGTTAATCTCCTTTTGTCTTTCTAGAGC
ATCAGTAGATGCATATGTATCCACATCTTGCTTTAAGTAGCCGTAATTTCAC

CDS

840 bp

>Os11t0264300-01 Similar to RWP-RK domain containing protein, expressed.
ATGGATGGAGGTGGGACGCCGGATGGGGATCCGGTGCCGGACATGGACATGCTCATGCTG
TCATCAGCGCTCGATGGCCTCGACAGCTACACCGACCTCGTCGCGGGTTCATCGGTAGCC
GACAGCATCTTCTCAGCTCTTACCTGTTTCCCACCATCACAAGAACGATTGCTGCACGTC
TCGACTCCTGTGGGTTCTAATTCTAGGCAAGATGATTCTGATGTTTCCATCACTAAGGAG
GGTACAACAACAAGAAGAGGTGATTGCGCCGCCGGATTAGCTTCAGGTGAGCCGGTGGCC
GCGGGAATTGGCTCTGTCCCGAAGCCGTTCGACGGCGTCACACTGACGGAGAGGATGCTC
AGGGCGCTTGCGATGCTCAAAGAGGCGTCGGGTGGCGAAGCGATCCTTGTGCAGGTCTGG
ATGCCTGTGAGGAATGGGGAGCAGCATGTGCTGACTACCTCTGACCAGCCGTTCTTGCTC
GATCAGAAGCTTACGGGATACAGGGAAGTCTCCAGGCAGTTCACATTCTCGGCTGAAGAA
GGACCCGGTCTGTTCCCCGGATTGCCCGGCCGGGTTTTCATGTCCGGCATGCCAGAGTGG
ACGTCGAATGTGATGTACTATCATGGCTCGGAGTATTTGAGGGTTGATTATGCTAGGCGC
CACGAGGTCCGTGGATCCCTTGCGATGCCGGTTTTCAACTCAAGTGGTGGGTCTTGCTGT
GCAGTGTTAGAAGTAGTAATGACACGAGAGAAGGATAACTTTTGCTTAGAGATGGTCAAT
GTTTCGAATGCTCTGCAGGGCACACATGACTTGAACACACAGCACAGAAAGAATGACTAA

Protein

280 aa

>Os11t0264300-01 Similar to RWP-RK domain containing protein, expressed.
MDGGGTPDGDPVPDMDMLMLSSALDGLDSYTDLVAGSSVADSIFSALTCFPPSQERLLHV
STPVGSNSRQDDSDVSITKEGTTTRRGDCAAGLASGEPVAAGIGSVPKPFDGVTLTERML
RALAMLKEASGGEAILVQVWMPVRNGEQHVLTTSDQPFLLDQKLTGYREVSRQFTFSAEE
GPGLFPGLPGRVFMSGMPEWTSNVMYYHGSEYLRVDYARRHEVRGSLAMPVFNSSGGSCC
AVLEVVMTREKDNFCLEMVNVSNALQGTHDLNTQHRKND*

5'UTR

chr11:8977314..8977440 (- strand) : 127 bp

chr11:8977113..8977206 (- strand) : 94 bp

CDS

chr11:8976315..8977112 (- strand) : 798 bp

chr11:8975635..8975676 (- strand) : 42 bp

3'UTR

chr11:8975591..8975634 (- strand) : 44 bp

chr11:8975041..8975487 (- strand) : 447 bp

FASTA

>Os11t0264300-01 class=Sequence position=chr11:8975041..8977440 (- strand)
TCCCTATTCC ATTCCCTTTT CTCCTCCTCC TCCTCCTCCT CACCGCCGGC GGCGAGCGGC CGGCCGGCGA GCAGAGCAGA
GCAGAGGAGA GAGCCGACCT CCATCTGGGC TCCAATCGAA GCTGAAGGTA TCCGCTTTCC CCTCCTCCGG TATGGCGTTG
ATCGGAGATT TCTTCCCTTC CCCCCTCCCC TCCAAATTAC CTATTTTGAT CCGGTTTCTT TGATCGTGGT GCAGCGCCTC
GTCGTAGTTT GGGCAAAAGA AGTTTTGATT TTTTTTATTT ATTTTGGGTG CTGAGGAAGA GTGTAATTAA GCTGTGAGGA
TTGAGAAGAT GGATGGAGGT GGGACGCCGG ATGGGGATCC GGTGCCGGAC ATGGACATGC TCATGCTGTC ATCAGCGCTC
GATGGCCTCG ACAGCTACAC CGACCTCGTC GCGGGTTCAT CGGTAGCCGA CAGCATCTTC TCAGCTCTTA CCTGTTTCCC
ACCATCACAA GAACGATTGC TGCACGTCTC GACTCCTGTG GGTTCTAATT CTAGGCAAGA TGATTCTGAT GTTTCCATCA
CTAAGGAGGG TACAACAACA AGAAGAGGTG ATTGCGCCGC CGGATTAGCT TCAGGTGAGC CGGTGGCCGC GGGAATTGGC
TCTGTCCCGA AGCCGTTCGA CGGCGTCACA CTGACGGAGA GGATGCTCAG GGCGCTTGCG ATGCTCAAAG AGGCGTCGGG
TGGCGAAGCG ATCCTTGTGC AGGTCTGGAT GCCTGTGAGG AATGGGGAGC AGCATGTGCT GACTACCTCT GACCAGCCGT
TCTTGCTCGA TCAGAAGCTT ACGGGATACA GGGAAGTCTC CAGGCAGTTC ACATTCTCGG CTGAAGAAGG ACCCGGTCTG
TTCCCCGGAT TGCCCGGCCG GGTTTTCATG TCCGGCATGC CAGAGTGGAC GTCGAATGTG ATGTACTATC ATGGCTCGGA
GTATTTGAGG GTTGATTATG CTAGGCGCCA CGAGGTCCGT GGATCCCTTG CGATGCCGGT TTTCAACTCA AGTGGTGGGT
CTTGCTGTGC AGTGTTAGAA GTAGTAATGA CACGAGAGAA GGATAACTTT TGCTTAGAGA TGGTCAATGT TTCGAATGCT
CTGCAGGTTA GTACTTGTAT TTGCCTTGCT ATAAATTGTT CTCCTTTTCA GAATTGAACT GTTCCCATAA TTTGTTTTTA
TCCATTTTCA CTATGCCTTC AGAGTAACGC ATGATAAACA TTCAAATTAA ATGTTTCAAC ATTTTTCATT TGTTTCATAT
AGGGAAATTT GAATAATTTG CTTACCTTGA TCAACTTGAG GTCCTTGTTT GTCTTCAAAA CATCCATAGC AAGCCTATGT
GGTATAAGCA TATCTATAAG TCACTGATAG GCTGATAGCT CTAGTGAGTA GTGATAGCTC TGAAAGTTGT TCTAGACCTT
ATGAAGTCGT GCTGTTAGAT ATGTACAGAT TTTGCAACTA CCTTTTTATC TAACTTCTTG TATGGAATAA ATAACTTTTG
TTAGATAGAC ACAGGTTTTG CTTTTGAAAG TTGGAACAAT TCTTTCTGTT GATTCATGCT GACGAACTAA GCAGATTCAG
TTTTTCTGAT GGGAATTTTT TTGTTACTAC TGAAACCATT TCTTCACCAT TCATCGCCCC TTTTTTCTAT TAATAGAAAT
GATCAGGAAA TAAGAATTCA TGCAGGAAAT TAAAATGATA TTGTGTTAGA CGGTCTAACA GAGTGATATC TCTTTTCATC
AAAGGGCACA CATGACTTGA ACACACAGCA CAGAAAGAAT GACTAACATC AGATGGACAC CTTACAAACA CAATTTCAGT
CAATGCCTAG GTACTTACTT TCTCTGATCC CGCTTACAGC TCTGCGCACT ATTTTTTTTC TACAAAATAG CCCAGAAATC
AACAGTAATG AATTTCATAC ATGATCTTGG TAGGGTCAGT CGGGAAGACA AGCTGAGTTT CTTGTCCTTT ATATCACCCA
CAAACACAAG CCACCCCCAA TCATCCAGAA CTAGTTGGAA TTTGGAAACC GGGCAATCCA TCCAATCCCA AATATCCCCA
ATTGAGGTAG GTGATCTAGC ATGATGTATG CTCAACTGAC CATGAACTTT GCTAGCACAC ATTTTCAAAA TGTTTCTCAG
GACACTCACC GAACTTGCAA TTCTGGGAAC TCTTCTAACA TGAGTTATCT TTAGTCAAAA TATTTCTGCA CAGCAGCCAC
GAGTTTTTTT TTTCCTCTAA GGCTGGTTGC TTAGTCTCCC AGCAGATGTA AAGAATAAAG ACGGCCATAT ACATAGCTTT
TGTTAATCTC CTTTTGTCTT TCTAGAGCAT CAGTAGATGC ATATGTATCC ACATCTTGCT TTAAGTAGCC GTAATTTCAC