Os11t0264300-02

Locus

Os11g0264300

Description

Similar to RWP-RK domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

OsNIN-like4, OsNIN-like 4, NIN-like4, NIN-like 4

Transcript Evidence

AK064859 (DDBJ, Best hit)

Protein Evidence

Q2R7K6 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J013000H14 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0264300-02)

Others

Oryzabase (21543)

Transcript

3545 bp

>Os11t0264300-02 Similar to RWP-RK domain containing protein, expressed.
ATTCCATTCCCTTTTCTCCTCCTCCTCCTCCTCCTCACCGCCGGCGGCGAGCGGCCGGCC
GGCGAGCAGAGCAGAGCAGAGGAGAGAGCCGACCTCCATCTGGGCTCCAATCGAAGCTGA
AGCGCCTCGTCGTAGTTTGGGCAAAAGAAGTTTTGATTTTTTTTATTTATTTTGGGTGCT
GAGGAAGAGTGTAATTAAGCTGTGAGGATTGAGAAGATGGATGGAGGTGGGACGCCGGAT
GGGGATCCGGTGCCGGACATGGACATGCTCATGCTGTCATCAGCGCTCGATGGCCTCGAC
AGCTACACCGACCTCGTCGCGGGTTCATCGGTAGCCGACAGCATCTTCTCAGCTCTTACC
TGTTTCCCACCATCACAAGAACGATTGCTGCACGTCTCGACTCCTGTGGGTTCTAATTCT
AGGCAAGATGATTCTGATGTTTCCATCACTAAGGAGGGTACAACAACAAGAAGAGGTGAT
TGCGCCGCCGGATTAGCTTCAGGTGAGCCGGTGGCCGCGGGAATTGGCTCTGTCCCGAAG
CCGTTCGACGGCGTCACACTGACGGAGAGGATGCTCAGGGCGCTTGCGATGCTCAAAGAG
GCGTCGGGTGGCGAAGCGATCCTTGTGCAGGTCTGGATGCCTGTGAGGAATGGGGAGCAG
CATGTGCTGACTACCTCTGACCAGCCGTTCTTGCTCGATCAGAAGCTTACGGGATACAGG
GAAGTCTCCAGGCAGTTCACATTCTCGGCTGAAGAAGGACCCGGTCTGTTCCCCGGATTG
CCCGGCCGGGTTTTCATGTCCGGCATGCCAGAGTGGACGTCGAATGTGATGTACTATCAT
GGCTCGGAGTATTTGAGGGTTGATTATGCTAGGCGCCACGAGGTCCGTGGATCCCTTGCG
ATGCCGGTTTTCAACTCAAGTGGTGGGTCTTGCTGTGCAGTGTTAGAAGTAGTAATGACA
CGAGAGAAGGATAACTTTTGCTTAGAGATGGTCAATGTTTCGAATGCTCTGCAGAGTTCT
ATAATTTCTGATGAGGCCTTTCAAATGATTAACTTCGGGTGAATTCCTATTTCTCCTACC
CTTGGTTTCACACAGACTACATCTGGTCTTTTTCTTAAAGAGACCATAAAGGTATTTTCT
ATCTCGAGAAAAAATAATCTATAGTTTCCTCGTCTTTGAGGATACAAGGTTTGTACTATC
CTAGGAGGATTAATCAGCACTCTCCTGTACTGATCCCTCCCTAGTCTGCTCTTTGTCCTT
GGATTTGATGCTACCAATATACATTTCACACTTTGGTTGTTCCAGGCCTTCAATAACCCA
TTATTCCTCCTTTGTGCTGCCCAACGTTACGCCCAATTGCAATGCAATACTGCTAAGTAC
CTCTTCAAAGAATTAAGTACTGTAGGTCATATGTTTGCCTTCCAGTTTCTCATTCCAAAT
CTATGTGTTTCACTAAGTCGGATCAATATCATGTACTGGAGCAAGAAGAATGATTGGAAG
CATAAATAGTCTGTTCAGTTAAGCACTGTCAATGCATGGAGACATTCTCAGAGCTATTCA
AGGGACCAGAAATTAGCATTGATGGAAATATTCGATGTTCTGCAAGCTGTTTGTCAAGCA
CACTTGCTACCTTTGGCACTTGCATGGATTCCAGTTTGCTCCAAAAGAGATGTGCTTGTG
TCAGTAGAATATGGTGCAAATTTTGGTAAAAGGAACAAAGAAGTGCTTTGCATAGAGGAA
TCTGCATGTTATGTCAATGACACGAGAATGCGTGATTTTGTCCAAGTCTGTGCTGAACAC
CCCCTTGAGAAAGGACAAGGTGTCGCTGGAAATGCATATTTATCAAATAATCCCTTCTTC
TCATCTGATGTGAAGGATTATGATATGCACGCTTATCCACTTGTCAATCATGCCCGTAAA
TTTGGTCTTCATGCTGCTGTTGCAATTAGGCTGCAGAGCACATACACCAAAAATGATGAC
TATGTGCTTGAGTTTTTTCTTCCAGTCTTGTGCAAAGGTGGTGGAGAACAACAGCTCTTA
CTTGACAGCATATCTGCGACTATGCGGAGAGTATGCAAAAGTCTGAGAACTGTTTCAGAT
GCTGAGTTGAAGGAAGATGTTACAAGAAAGCCATCAAATGAAAATCGATCAGGAACAAGA
TGCCCTTCACCTGTTAACCTTATTTATTCAGGCCGAGAAATTGATGTATCGAATGAAACA
AAAACAAATACGCCTTTGGAATATCAGATAGAGGGCATTGATGAACAACTATCAGATACA
AAAAGTACTAACAAGTTAATAAAGTGTAGCAATGCATCCGACGGAGAGAAAAGACGCAGC
TCAACAGAGAAGAGTGTTAGCTTAAGTGTCCTCCAGCAGTACTTCTCTGGCAGCCTGAAA
GATGCTGCAAAGAGTATTGGTGTTTGTCCTACTACGCTGAAAAGGATATGCAGACAACAT
GGAATATCAAGGTGGCCATCTCGTAAGATAAAGAAGGTAAACCGATCCCTAAAGAAGATC
CAGAACGTCATAAGTTCAGTACATGGAGTCGAGGGAGTGCTGAAATATGATCCTTCCACT
GGATGCCTTGTTTCATCTGTTTCCCCTTCCATAGAGCCTGTATTGATGAATGTTGAACAC
AAAGAGAACATGCAGGCCAAGATGTACTCCACAAACTGCAGAATAAGCAAAATGGTGAAA
TTAATTTTGACATGGACGATGGAGAATTATTTCGAAACTCACATTCTACCAGAACATTGA
GTGGGGCATTCTGTGAGGATATGCCAAATGGTTTATATGTTGCAAGGGAAATGACTTGTG
TTGCGAAAACTGGCACGAGGACGGAGAGACTGGAGCACAAACCATCATCAAGGGATTCTT
TTTCTGCGCCACAAGAATACAGAATGGAGAGTGAGACTGACAAGAGCAATAAGAATTCCA
AACAAAGCCTACCGTCCTCTTCCAGCATGACAGATTGCTCCACATCAAGCGGCGAAACTT
TCAAGAGCATCAAGAGTCAGTCAGCTAACGAAAGCAACAAAACCGTCGTCGTAAAGGCGA
GCTACAAGAATGACACCATAAGGTTCAAATTGCTACCATCCATGAAATACGAGCAGCTGC
TCGAGGAAATAGCGAAGAGGCTGAAACTGTCAATTGGCCTATTTCAGCTCAAGTACAAAG
ACGATGAGGGTGACTGGGTGATTTTAGCGAGCGATGCGGATCTCCAGGAATGCCTCGAGA
TACTTGACACCACCAGGTTGCGTATCTTGAAGCTTCAGGTGCAAGATGTTGTGTGTCCTA
TCGGAAGTTCGTCAGGTAGCTGCTCCATGTTACGTCCATAGGTTAGGATACTACTACAAA
TGCAAAAAATGAGAAACCAATCGTGGAGTTCTACTTATTTTGAGTAATTGTACAAAAGGA
CGTAGGTATCTTGAGGAAAGCTAAGGTGCTAGTTTTGGTTTATGATCTTGAATATTCACA
GTATGGTGCTTTGAAACATGTACATATTTATGAAACCCGGTGCAATAGAGTCGAAGGATG
TTTGC

CDS

846 bp

>Os11t0264300-02 Similar to RWP-RK domain containing protein, expressed.
ATGGATGGAGGTGGGACGCCGGATGGGGATCCGGTGCCGGACATGGACATGCTCATGCTG
TCATCAGCGCTCGATGGCCTCGACAGCTACACCGACCTCGTCGCGGGTTCATCGGTAGCC
GACAGCATCTTCTCAGCTCTTACCTGTTTCCCACCATCACAAGAACGATTGCTGCACGTC
TCGACTCCTGTGGGTTCTAATTCTAGGCAAGATGATTCTGATGTTTCCATCACTAAGGAG
GGTACAACAACAAGAAGAGGTGATTGCGCCGCCGGATTAGCTTCAGGTGAGCCGGTGGCC
GCGGGAATTGGCTCTGTCCCGAAGCCGTTCGACGGCGTCACACTGACGGAGAGGATGCTC
AGGGCGCTTGCGATGCTCAAAGAGGCGTCGGGTGGCGAAGCGATCCTTGTGCAGGTCTGG
ATGCCTGTGAGGAATGGGGAGCAGCATGTGCTGACTACCTCTGACCAGCCGTTCTTGCTC
GATCAGAAGCTTACGGGATACAGGGAAGTCTCCAGGCAGTTCACATTCTCGGCTGAAGAA
GGACCCGGTCTGTTCCCCGGATTGCCCGGCCGGGTTTTCATGTCCGGCATGCCAGAGTGG
ACGTCGAATGTGATGTACTATCATGGCTCGGAGTATTTGAGGGTTGATTATGCTAGGCGC
CACGAGGTCCGTGGATCCCTTGCGATGCCGGTTTTCAACTCAAGTGGTGGGTCTTGCTGT
GCAGTGTTAGAAGTAGTAATGACACGAGAGAAGGATAACTTTTGCTTAGAGATGGTCAAT
GTTTCGAATGCTCTGCAGAGTTCTATAATTTCTGATGAGGCCTTTCAAATGATTAACTTC
GGGTGA

Protein

282 aa

>Os11t0264300-02 Similar to RWP-RK domain containing protein, expressed.
MDGGGTPDGDPVPDMDMLMLSSALDGLDSYTDLVAGSSVADSIFSALTCFPPSQERLLHV
STPVGSNSRQDDSDVSITKEGTTTRRGDCAAGLASGEPVAAGIGSVPKPFDGVTLTERML
RALAMLKEASGGEAILVQVWMPVRNGEQHVLTTSDQPFLLDQKLTGYREVSRQFTFSAEE
GPGLFPGLPGRVFMSGMPEWTSNVMYYHGSEYLRVDYARRHEVRGSLAMPVFNSSGGSCC
AVLEVVMTREKDNFCLEMVNVSNALQSSIISDEAFQMINFG*

5'UTR

chr11:8977314..8977435 (- strand) : 122 bp

chr11:8977113..8977206 (- strand) : 94 bp

CDS

chr11:8976315..8977112 (- strand) : 798 bp

chr11:8973963..8974010 (- strand) : 48 bp

3'UTR

chr11:8973516..8973962 (- strand) : 447 bp

chr11:8973013..8973054 (- strand) : 42 bp

chr11:8972192..8972935 (- strand) : 744 bp

chr11:8971533..8971659 (- strand) : 127 bp

chr11:8971121..8971342 (- strand) : 222 bp

chr11:8970147..8971047 (- strand) : 901 bp

FASTA

>Os11t0264300-02 class=Sequence position=chr11:8970147..8977435 (- strand)
ATTCCATTCC CTTTTCTCCT CCTCCTCCTC CTCCTCACCG CCGGCGGCGA GCGGCCGGCC GGCGAGCAGA GCAGAGCAGA
GGAGAGAGCC GACCTCCATC TGGGCTCCAA TCGAAGCTGA AGGTATCCGC TTTCCCCTCC TCCGGTATGG CGTTGATCGG
AGATTTCTTC CCTTCCCCCC TCCCCTCCAA ATTACCTATT TTGATCCGGT TTCTTTGATC GTGGTGCAGC GCCTCGTCGT
AGTTTGGGCA AAAGAAGTTT TGATTTTTTT TATTTATTTT GGGTGCTGAG GAAGAGTGTA ATTAAGCTGT GAGGATTGAG
AAGATGGATG GAGGTGGGAC GCCGGATGGG GATCCGGTGC CGGACATGGA CATGCTCATG CTGTCATCAG CGCTCGATGG
CCTCGACAGC TACACCGACC TCGTCGCGGG TTCATCGGTA GCCGACAGCA TCTTCTCAGC TCTTACCTGT TTCCCACCAT
CACAAGAACG ATTGCTGCAC GTCTCGACTC CTGTGGGTTC TAATTCTAGG CAAGATGATT CTGATGTTTC CATCACTAAG
GAGGGTACAA CAACAAGAAG AGGTGATTGC GCCGCCGGAT TAGCTTCAGG TGAGCCGGTG GCCGCGGGAA TTGGCTCTGT
CCCGAAGCCG TTCGACGGCG TCACACTGAC GGAGAGGATG CTCAGGGCGC TTGCGATGCT CAAAGAGGCG TCGGGTGGCG
AAGCGATCCT TGTGCAGGTC TGGATGCCTG TGAGGAATGG GGAGCAGCAT GTGCTGACTA CCTCTGACCA GCCGTTCTTG
CTCGATCAGA AGCTTACGGG ATACAGGGAA GTCTCCAGGC AGTTCACATT CTCGGCTGAA GAAGGACCCG GTCTGTTCCC
CGGATTGCCC GGCCGGGTTT TCATGTCCGG CATGCCAGAG TGGACGTCGA ATGTGATGTA CTATCATGGC TCGGAGTATT
TGAGGGTTGA TTATGCTAGG CGCCACGAGG TCCGTGGATC CCTTGCGATG CCGGTTTTCA ACTCAAGTGG TGGGTCTTGC
TGTGCAGTGT TAGAAGTAGT AATGACACGA GAGAAGGATA ACTTTTGCTT AGAGATGGTC AATGTTTCGA ATGCTCTGCA
GGTTAGTACT TGTATTTGCC TTGCTATAAA TTGTTCTCCT TTTCAGAATT GAACTGTTCC CATAATTTGT TTTTATCCAT
TTTCACTATG CCTTCAGAGT AACGCATGAT AAACATTCAA ATTAAATGTT TCAACATTTT TCATTTGTTT CATATAGGGA
AATTTGAATA ATTTGCTTAC CTTGATCAAC TTGAGGTCCT TGTTTGTCTT CAAAACATCC ATAGCAAGCC TATGTGGTAT
AAGCATATCT ATAAGTCACT GATAGGCTGA TAGCTCTAGT GAGTAGTGAT AGCTCTGAAA GTTGTTCTAG ACCTTATGAA
GTCGTGCTGT TAGATATGTA CAGATTTTGC AACTACCTTT TTATCTAACT TCTTGTATGG AATAAATAAC TTTTGTTAGA
TAGACACAGG TTTTGCTTTT GAAAGTTGGA ACAATTCTTT CTGTTGATTC ATGCTGACGA ACTAAGCAGA TTCAGTTTTT
CTGATGGGAA TTTTTTTGTT ACTACTGAAA CCATTTCTTC ACCATTCATC GCCCCTTTTT TCTATTAATA GAAATGATCA
GGAAATAAGA ATTCATGCAG GAAATTAAAA TGATATTGTG TTAGACGGTC TAACAGAGTG ATATCTCTTT TCATCAAAGG
GCACACATGA CTTGAACACA CAGCACAGAA AGAATGACTA ACATCAGATG GACACCTTAC AAACACAATT TCAGTCAATG
CCTAGGTACT TACTTTCTCT GATCCCGCTT ACAGCTCTGC GCACTATTTT TTTTCTACAA AATAGCCCAG AAATCAACAG
TAATGAATTT CATACATGAT CTTGGTAGGG TCAGTCGGGA AGACAAGCTG AGTTTCTTGT CCTTTATATC ACCCACAAAC
ACAAGCCACC CCCAATCATC CAGAACTAGT TGGAATTTGG AAACCGGGCA ATCCATCCAA TCCCAAATAT CCCCAATTGA
GGTAGGTGAT CTAGCATGAT GTATGCTCAA CTGACCATGA ACTTTGCTAG CACACATTTT CAAAATGTTT CTCAGGACAC
TCACCGAACT TGCAATTCTG GGAACTCTTC TAACATGAGT TATCTTTAGT CAAAATATTT CTGCACAGCA GCCACGAGTT
TTTTTTTTCC TCTAAGGCTG GTTGCTTAGT CTCCCAGCAG ATGTAAAGAA TAAAGACGGC CATATACATA GCTTTTGTTA
ATCTCCTTTT GTCTTTCTAG AGCATCAGTA GATGCATATG TATCCACATC TTGCTTTAAG TAGCCGTAAT TTCACAGTTC
CATCTACAAG ATCTCCTTCT GAAATGAATG CAATGGCTAA CACCTCAAAA ACTTTAGCCA CTGAAACTTT TTGACTAAAA
GTGAGATCAT AAAGCCTAGT AAACTATTTT GCCAAAGAGC TATCTCCCAG CCAAACATCA TCCGAGAAAT GTGCATGTTC
TCTGTTACCA ATTATTTTAT TGCAGAATGA TAACAAAATG TCTTTGACAA CTATCAATCC TGCGcagaaa tttgaatctg
actgttttgg tttcaatagc tatggaggaa tttttgcctg aatgcttaga ccttagtaat tcctgccaag gtcctccatg
gttctccaat ttccatagcc acttcgataa aaggcagata ttcatgaggt ataaatcaag tatgcctagt ccacattatg
ttttttggtg acaaaccact ggctacttta caatacggta atttcttgta tcttcttgcc ataaaagcct agatctaaaa
acatcatttt tttttgcaag ggaccttcaa cacacctttc agaatgctaa aaagtgaaat catataagaa ggaacattac
taatacatga atcaagtaaa actaacctgc caccaattgg caacttctta ccctgctaat tgtttaattt cttttcaacc
ttttcctcta cccctttcaa accactgttc ctttatttct tttgttatga atggggatac ccaaatattt aaatggcaat
attcccttct gacaggtgaa agtcagagca taatcatcct gtagttttcg cctctgtaaa acaatacact gcactctgat
gagaattaat cttaatacac tgttttgctc aaacaaacaa atgataaata tcacatttct agactctaac aaactatcat
ccaatgagaa aatagtgtca tcagcatatt gtaaaatttc caaggactca ttacataaat atcacgtgaa gcgacttaga
ataccttgtt cttgagctct cttaaccaGA AACTTATTTT TTTTCTCCTG CGACTAAATT TGTAGAGTTC TATAATTTCT
GATGAGGCCT TTCAAATGAT TAACTTCGGG TGAATTCCTA TTTCTCCTAC CCTTGGTTTC ACACAGACTA CATCTGGTCT
TTTTCTTAAA GAGACCATAA AGGTATTTTC TATCTCGAGA AAAAATAATC TATAGTTTCC TCGTCTTTGA GGATACAAGG
TTTGTACTAT CCTAGGAGGA TTAATCAGCA CTCTCCTGTA CTGATCCCTC CCTAGTCTGC TCTTTGTCCT TGGATTTGAT
GCTACCAATA TACATTTCAC ACTTTGGTTG TTCCAGGCCT TCAATAACCC ATTATTCCTC CTTTGTGCTG CCCAACGTTA
CGCCCAATTG CAATGCAATA CTGCTAAGTA CCTCTTCAAA GAATTAAGTA CTGTAGGTCA TATGTTTGCC TTCCAGTTTC
TCATTCCAAA TCTATGTGTT TCACTAAGTC GGATCAATAT CATGTACTGG AGCAAGAAGA ATGATTGGAA GCATAAATAG
GTACCAAGTT TGTCTAATCA GGAATTAGTT TTACTTGGTA GTTGGTACAT CCGAACTATT GGTGTGCTCT GTGCACTCAT
CAACTAGATT ACTTAAAATG CTTTCTTTTA TTATGTGGAT GGTTCAGCTA TGAGACATTT AGCTTTATTT TTGAGTTATT
TATATAGTTA ATATCAATTA TTATTTGCTC TTATCACCAA TATTATTAGT TTCTATTCTA ATTTCTATGC ATGGTACAAG
GTTTGACTTT TGCTCAAATA TGCTTAAAAC TCTCCAGAGT TATGGCTTGT TTTTTCACCG TAGAGTTGCT ATGGCTACTT
TTTTTCACTT GAGGGTGCTC ATAATTATTT CCATCCGAGC GTGCATATAT GGTTGTAATT TGTTCTAGAA CATTTTGTTA
TAAAGTTCAT TTCATGATTG AATTAGCCTC TGAGCTTAAT AGTGACATTG TAATCTTGCA GTCTGTTCAG TTAAGCACTG
TCAATGCATG GAGACATTCT CAGGTACCAA TCTACTACAC AGTCAGTGCA CATGGAGAGC TCATTAATTC AACATTTTCT
TGCTTTACTT GATCTTGCAG AGCTATTCAA GGGACCAGAA ATTAGCATTG ATGGAAATAT TCGATGTTCT GCAAGCTGTT
TGTCAAGCAC ACTTGCTACC TTTGGCACTT GCATGGATTC CAGTTTGCTC CAAAAGAGAT GTGCTTGTGT CAGTAGAATA
TGGTGCAAAT TTTGGTAAAA GGAACAAAGA AGTGCTTTGC ATAGAGGAAT CTGCATGTTA TGTCAATGAC ACGAGAATGC
GTGATTTTGT CCAAGTCTGT GCTGAACACC CCCTTGAGAA AGGACAAGGT GTCGCTGGAA ATGCATATTT ATCAAATAAT
CCCTTCTTCT CATCTGATGT GAAGGATTAT GATATGCACG CTTATCCACT TGTCAATCAT GCCCGTAAAT TTGGTCTTCA
TGCTGCTGTT GCAATTAGGC TGCAGAGCAC ATACACCAAA AATGATGACT ATGTGCTTGA GTTTTTTCTT CCAGTCTTGT
GCAAAGGTGG TGGAGAACAA CAGCTCTTAC TTGACAGCAT ATCTGCGACT ATGCGGAGAG TATGCAAAAG TCTGAGAACT
GTTTCAGATG CTGAGTTGAA GGAAGATGTT ACAAGAAAGC CATCAAATGA AAATCGATCA GGAACAAGAT GCCCTTCACC
TGTTAACCTT ATTTATTCAG GCCGAGAAAT TGATGTATCG AATGAAACAA AAACAAATAC GCCTTTGGAA TATCAGATAG
AGGGCATTGA TGAACAACTA TCAGATACAA AAAGTACTAA CAAGGTTGTT TCATCCTCAA CATTCTCACT ATGTGCTTTC
ATCCTCTCTT ATCTGTCGTG TGGTCTGTTT TTCTTTGTGT GCTTTAGTCA TTCAGACATG AACAATTGGA AGTGATAACT
CTGCAGGATA GTTTTTTCAG TAAATTGTTT GAATAGTTCC TTACAGATTA AGCATTGTCC ATTTTCTTGT GCTGCATTGC
AATTTAACTG TATAGATCTG ATCTCTTTGC ATCATCTGGT GTTATTTTCT TGCTTTTTAC TTCAATAAAT ATGTCCCAAA
TGTTACAGAG AACAACTAAA ATGCTACTTA AGTAATTACT GTTTAAAATA GCTTACTTGT CAACGCCTTT GGAATTGAGA
AATTTAAGCC CTGTAAGAAG TTACCTCGGA ACCAATCTTT TCAATTTATA ATCAGCATCT AAACAACCAG AAACTTCTAT
ATATCCTGTA AATTCCGTAT TGTGTTATTC ATGTTACACA AAGTTGTAGT TTAACCACTT AAAATATTGT CTAATCTCCA
TTTATTTCTT TTGAAGTTAA TAAAGTGTAG CAATGCATCC GACGGAGAGA AAAGACGCAG CTCAACAGAG AAGAGTGTTA
GCTTAAGTGT CCTCCAGCAG TACTTCTCTG GCAGCCTGAA AGATGCTGCA AAGAGTATTG GTGGTAATTT GTTTATACTC
TCATGATCTT TTTCTGATTT ATTCTTATAG AATTCAATTA ATTCCTACTA AATTAGTTCT GTTTTGTATG AAAAGCACTA
CTGCTAATAC AAATGTAGAA ACAAACTAAT CCAATTGTGT CATAGGAAGA GGAGCTTACA GGATTTTTTT TATTCCTTGC
TGTTACGTTG CAGTTTGTCC TACTACGCTG AAAAGGATAT GCAGACAACA TGGAATATCA AGGTGGCCAT CTCGTAAGAT
AAAGAAGGTA AACCGATCCC TAAAGAAGAT CCAGAACGTC ATAAGTTCAG TACATGGAGT CGAGGGAGTG CTGAAATATG
ATCCTTCCAC TGGATGCCTT GTTTCATCTG TTTCCCCTTC CATAGAGCCT GTATTGATGA ATGTTGAACA CAAAGGTTCT
GATCCCCTAC CTATTGAATC TGAACTTCCA CATTTGAACT TCGAACCTGA CTGTGATGCA TATCGAAGAG AACATGCAGG
CCAAGATGTA CTCCACAAAC TGCAGAATAA GCAAAATGGT GAAATTAATT TTGACATGGA CGATGGAGAA TTATTTCGAA
ACTCACATTC TACCAGAACA TTGAGTGGGG CATTCTGTGA GGATATGCCA AATGGTTTAT ATGTTGCAAG GGAAATGACT
TGTGTTGCGA AAACTGGCAC GAGGACGGAG AGACTGGAGC ACAAACCATC ATCAAGGGAT TCTTTTTCTG CGCCACAAGA
ATACAGAATG GAGAGTGAGA CTGACAAGAG CAATAAGAAT TCCAAACAAA GCCTACCGTC CTCTTCCAGC ATGACAGATT
GCTCCACATC AAGCGGCGAA ACTTTCAAGA GCATCAAGAG TCAGTCAGCT AACGAAAGCA ACAAAACCGT CGTCGTAAAG
GCGAGCTACA AGAATGACAC CATAAGGTTC AAATTGCTAC CATCCATGAA ATACGAGCAG CTGCTCGAGG AAATAGCGAA
GAGGCTGAAA CTGTCAATTG GCCTATTTCA GCTCAAGTAC AAAGACGATG AGGGTGACTG GGTGATTTTA GCGAGCGATG
CGGATCTCCA GGAATGCCTC GAGATACTTG ACACCACCAG GTTGCGTATC TTGAAGCTTC AGGTGCAAGA TGTTGTGTGT
CCTATCGGAA GTTCGTCAGG TAGCTGCTCC ATGTTACGTC CATAGGTTAG GATACTACTA CAAATGCAAA AAATGAGAAA
CCAATCGTGG AGTTCTACTT ATTTTGAGTA ATTGTACAAA AGGACGTAGG TATCTTGAGG AAAGCTAAGG TGCTAGTTTT
GGTTTATGAT CTTGAATATT CACAGTATGG TGCTTTGAAA CATGTACATA TTTATGAAAC CCGGTGCAAT AGAGTCGAAG
GATGTTTGC