Os11t0264300-03

Locus

Os11g0264300

Description

Similar to RWP-RK domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

OsNIN-like4, OsNIN-like 4, NIN-like4, NIN-like 4

Transcript Evidence

AK068456 (DDBJ, Best hit)

Protein Evidence

Q2R7K6 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J013152E20 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0264300-03)

RiceXPro (AK068456)

Others

Oryzabase (21543)

KEGG (Os11t0264300-03)

Transcript

2908 bp

>Os11t0264300-03 Similar to RWP-RK domain containing protein, expressed.
TTCCCTTTTCTCCTCCTCCTCCTCCTCCTCACCGCCGGCGGCGAGCGGCCGGCCGGCGAG
CAGAGCAGAGCAGAGGAGAGAGCCGACCTCCATCTGGGCTCCAATCGAAGCTGAAGCGCC
TCGTCGTAGTTTGGGCAAAAGAAGTTTTGATTTTTTTTATTTATTTTGGGTGCTGAGGAA
GAGTGTAATTAAGCTGTGAGGATTGAGAAGATGGATGGAGGTGGGACGCCGGATGGGGAT
CCGGTGCCGGACATGGACATGCTCATGCTGTCATCAGCGCTCGATGGCCTCGACAGCTAC
ACCGACCTCGTCGCGGGTTCATCGGTAGCCGACAGCATCTTCTCAGCTCTTACCTGTTTC
CCACCATCACAAGAACGATTGCTGCACGTCTCGACTCCTGTGGGTTCTAATTCTAGGCAA
GATGATTCTGATGTTTCCATCACTAAGGAGGGTACAACAACAAGAAGAGGTGATTGCGCC
GCCGGATTAGCTTCAGGTGAGCCGGTGGCCGCGGGAATTGGCTCTGTCCCGAAGCCGTTC
GACGGCGTCACACTGACGGAGAGGATGCTCAGGGCGCTTGCGATGCTCAAAGAGGCGTCG
GGTGGCGAAGCGATCCTTGTGCAGGTCTGGATGCCTGTGAGGAATGGGGAGCAGCATGTG
CTGACTACCTCTGACCAGCCGTTCTTGCTCGATCAGAAGCTTACGGGATACAGGGAAGTC
TCCAGGCAGTTCACATTCTCGGCTGAAGAAGGACCCGGTCTGTTCCCCGGATTGCCCGGC
CGGGTTTTCATGTCCGGCATGCCAGAGTGGACGTCGAATGTGATGTACTATCATGGCTCG
GAGTATTTGAGGGTTGATTATGCTAGGCGCCACGAGGTCCGTGGATCCCTTGCGATGCCG
GTTTTCAACTCAAGTGGTGGGTCTTGCTGTGCAGTGTTAGAAGTAGTAATGACACGAGAG
AAGGATAACTTTTGCTTAGAGATGGTCAATGTTTCGAATGCTCTGCAGAGTTCTATAATT
TCTGATGAGGCCTTTCAAATGATTAACTTCGGGTGAATTCCTATTTCTCCTACCCTTGGT
TTCACACAGACTACATCTGGTCTTTTTCTTAAAGAGACCATAAAGGTATTTTCTATCTCG
AGAAAAAATAATCTATAGTTTCCTCGTCTTTGAGGATACAAGGTTTGTACTATCCTAGGA
GGATTAATCAGCACTCTCCTGTACTGATCCCTCCCTAGTCTGCTCTTTGTCCTTGGATTT
GATGCTACCAATATACATTTCACACTTTGGTTGTTCCAGGCCTTCAATAACCCATTATTC
CTCCTTTGTGCTGCCCAACGTTACGCCCAATTGCAATGCAATACTGCTAAGTACCTCTTC
AAAGAATTAAGTACTGTAGGTCATATGTTTGCCTTCCAGTTTCTCATTCCAAATCTATGT
GTTTCACTAAGTCGGATCAATATCATGTACTGGAGCAAGAAGAATGATTGGAAGCATAAA
TAGGTACCAAGTTTGTCTAATCAGGAATTAGTTTTACTTGGTAGTTGGTACATCCGAACT
ATTGGTGTGCTCTGTGCACTCATCAACTAGATTACTTAAAATGCTTTCTTTTATTATGTG
GATGGTTCAGCTATGAGACATTTAGCTTTATTTTTGAGTTATTTATATAGTTAATATCAA
TTATTATTTGCTCTTATCACCAATATTATTAGTTTCTATTCTAATTTCTATGCATGGTAC
AAGGTTTGACTTTTGCTCAAATATGCTTAAAACTCTCCAGAGTTATGGCTTGTTTTTTCA
CCGTAGAGTTGCTATGGCTACTTTTTTTCACTTGAGGGTGCTCATAATTATTTCCATCCG
AGCGTGCATATATGGTTGTAATTTGTTCTAGAACATTTTGTTATAAAGTTCATTTCATGA
TTGAATTAGCCTCTGAGCTTAATAGTGACATTGTAATCTTGCAGTCTGTTCAGTTAAGCA
CTGTCAATGCATGGAGACATTCTCAGAGCTATTCAAGGGACCAGAAATTAGCATTGATGG
AAATATTCGATGTTCTGCAAGCTGTTTGTCAAGCACACTTGCTACCTTTGGCACTTGCAT
GGATTCCAGTTTGCTCCAAAAGAGATGTGCTTGTGTCAGTAGAATATGGTGCAAATTTTG
GTAAAAGGAACAAAGAAGTGCTTTGCATAGAGGAATCTGCATGTTATGTCAATGACACGA
GAATGCGTGATTTTGTCCAAGTCTGTGCTGAACACCCCCTTGAGAAAGGACAAGGTGTCG
CTGGAAATGCATATTTATCAAATAATCCCTTCTTCTCATCTGATGTGAAGGATTATGATA
TGCACGCTTATCCACTTGTCAATCATGCCCGTAAATTTGGTCTTCATGCTGCTGTTGCAA
TTAGGCTGCAGAGCACATACACCAAAAATGATGACTATGTGCTTGAGTTTTTTCTTCCAG
TCTTGTGCAAAGGTGGTGGAGAACAACAGCTCTTACTTGACAGCATATCTGCGACTATGC
GGAGAGTATGCAAAAGTCTGAGAACTGTTTCAGATGCTGAGTTGAAGGAAGATGTTACAA
GAAAGCCATCAAATGAAAATCGATCAGGAACAAGATGCCCTTCACCTGTTAACCTTATTT
ATTCAGGCCGAGAAATTGATGTATCGAATGAAACAAAAACAAATACGCCTTTGGAATATC
AGATAGAGGGCATTGATGAACAACTATCAGATACAAAAAGTACTAACAAGGTTGTTTCAT
CCTCAACATTCTCACTATGTGCTTTCATCCTCTCTTATCTGTCGTGTGGTCTGTTTTTCT
TTGTGTGCTTTAGTCATTCAGACATGAACAATTGGAAGTGATAACTCTGCAGGATAGTTT
TTTCAGTAAATTGTTTGAATAGTTCCTT

CDS

846 bp

>Os11t0264300-03 Similar to RWP-RK domain containing protein, expressed.
ATGGATGGAGGTGGGACGCCGGATGGGGATCCGGTGCCGGACATGGACATGCTCATGCTG
TCATCAGCGCTCGATGGCCTCGACAGCTACACCGACCTCGTCGCGGGTTCATCGGTAGCC
GACAGCATCTTCTCAGCTCTTACCTGTTTCCCACCATCACAAGAACGATTGCTGCACGTC
TCGACTCCTGTGGGTTCTAATTCTAGGCAAGATGATTCTGATGTTTCCATCACTAAGGAG
GGTACAACAACAAGAAGAGGTGATTGCGCCGCCGGATTAGCTTCAGGTGAGCCGGTGGCC
GCGGGAATTGGCTCTGTCCCGAAGCCGTTCGACGGCGTCACACTGACGGAGAGGATGCTC
AGGGCGCTTGCGATGCTCAAAGAGGCGTCGGGTGGCGAAGCGATCCTTGTGCAGGTCTGG
ATGCCTGTGAGGAATGGGGAGCAGCATGTGCTGACTACCTCTGACCAGCCGTTCTTGCTC
GATCAGAAGCTTACGGGATACAGGGAAGTCTCCAGGCAGTTCACATTCTCGGCTGAAGAA
GGACCCGGTCTGTTCCCCGGATTGCCCGGCCGGGTTTTCATGTCCGGCATGCCAGAGTGG
ACGTCGAATGTGATGTACTATCATGGCTCGGAGTATTTGAGGGTTGATTATGCTAGGCGC
CACGAGGTCCGTGGATCCCTTGCGATGCCGGTTTTCAACTCAAGTGGTGGGTCTTGCTGT
GCAGTGTTAGAAGTAGTAATGACACGAGAGAAGGATAACTTTTGCTTAGAGATGGTCAAT
GTTTCGAATGCTCTGCAGAGTTCTATAATTTCTGATGAGGCCTTTCAAATGATTAACTTC
GGGTGA

Protein

282 aa

>Os11t0264300-03 Similar to RWP-RK domain containing protein, expressed.
MDGGGTPDGDPVPDMDMLMLSSALDGLDSYTDLVAGSSVADSIFSALTCFPPSQERLLHV
STPVGSNSRQDDSDVSITKEGTTTRRGDCAAGLASGEPVAAGIGSVPKPFDGVTLTERML
RALAMLKEASGGEAILVQVWMPVRNGEQHVLTTSDQPFLLDQKLTGYREVSRQFTFSAEE
GPGLFPGLPGRVFMSGMPEWTSNVMYYHGSEYLRVDYARRHEVRGSLAMPVFNSSGGSCC
AVLEVVMTREKDNFCLEMVNVSNALQSSIISDEAFQMINFG*

5'UTR

chr11:8977314..8977429 (- strand) : 116 bp

chr11:8977113..8977206 (- strand) : 94 bp

CDS

chr11:8976315..8977112 (- strand) : 798 bp

chr11:8973963..8974010 (- strand) : 48 bp

3'UTR

chr11:8973013..8973962 (- strand) : 950 bp

chr11:8972034..8972935 (- strand) : 902 bp

FASTA

>Os11t0264300-03 class=Sequence position=chr11:8972034..8977429 (- strand)
TTCCCTTTTC TCCTCCTCCT CCTCCTCCTC ACCGCCGGCG GCGAGCGGCC GGCCGGCGAG CAGAGCAGAG CAGAGGAGAG
AGCCGACCTC CATCTGGGCT CCAATCGAAG CTGAAGGTAT CCGCTTTCCC CTCCTCCGGT ATGGCGTTGA TCGGAGATTT
CTTCCCTTCC CCCCTCCCCT CCAAATTACC TATTTTGATC CGGTTTCTTT GATCGTGGTG CAGCGCCTCG TCGTAGTTTG
GGCAAAAGAA GTTTTGATTT TTTTTATTTA TTTTGGGTGC TGAGGAAGAG TGTAATTAAG CTGTGAGGAT TGAGAAGATG
GATGGAGGTG GGACGCCGGA TGGGGATCCG GTGCCGGACA TGGACATGCT CATGCTGTCA TCAGCGCTCG ATGGCCTCGA
CAGCTACACC GACCTCGTCG CGGGTTCATC GGTAGCCGAC AGCATCTTCT CAGCTCTTAC CTGTTTCCCA CCATCACAAG
AACGATTGCT GCACGTCTCG ACTCCTGTGG GTTCTAATTC TAGGCAAGAT GATTCTGATG TTTCCATCAC TAAGGAGGGT
ACAACAACAA GAAGAGGTGA TTGCGCCGCC GGATTAGCTT CAGGTGAGCC GGTGGCCGCG GGAATTGGCT CTGTCCCGAA
GCCGTTCGAC GGCGTCACAC TGACGGAGAG GATGCTCAGG GCGCTTGCGA TGCTCAAAGA GGCGTCGGGT GGCGAAGCGA
TCCTTGTGCA GGTCTGGATG CCTGTGAGGA ATGGGGAGCA GCATGTGCTG ACTACCTCTG ACCAGCCGTT CTTGCTCGAT
CAGAAGCTTA CGGGATACAG GGAAGTCTCC AGGCAGTTCA CATTCTCGGC TGAAGAAGGA CCCGGTCTGT TCCCCGGATT
GCCCGGCCGG GTTTTCATGT CCGGCATGCC AGAGTGGACG TCGAATGTGA TGTACTATCA TGGCTCGGAG TATTTGAGGG
TTGATTATGC TAGGCGCCAC GAGGTCCGTG GATCCCTTGC GATGCCGGTT TTCAACTCAA GTGGTGGGTC TTGCTGTGCA
GTGTTAGAAG TAGTAATGAC ACGAGAGAAG GATAACTTTT GCTTAGAGAT GGTCAATGTT TCGAATGCTC TGCAGGTTAG
TACTTGTATT TGCCTTGCTA TAAATTGTTC TCCTTTTCAG AATTGAACTG TTCCCATAAT TTGTTTTTAT CCATTTTCAC
TATGCCTTCA GAGTAACGCA TGATAAACAT TCAAATTAAA TGTTTCAACA TTTTTCATTT GTTTCATATA GGGAAATTTG
AATAATTTGC TTACCTTGAT CAACTTGAGG TCCTTGTTTG TCTTCAAAAC ATCCATAGCA AGCCTATGTG GTATAAGCAT
ATCTATAAGT CACTGATAGG CTGATAGCTC TAGTGAGTAG TGATAGCTCT GAAAGTTGTT CTAGACCTTA TGAAGTCGTG
CTGTTAGATA TGTACAGATT TTGCAACTAC CTTTTTATCT AACTTCTTGT ATGGAATAAA TAACTTTTGT TAGATAGACA
CAGGTTTTGC TTTTGAAAGT TGGAACAATT CTTTCTGTTG ATTCATGCTG ACGAACTAAG CAGATTCAGT TTTTCTGATG
GGAATTTTTT TGTTACTACT GAAACCATTT CTTCACCATT CATCGCCCCT TTTTTCTATT AATAGAAATG ATCAGGAAAT
AAGAATTCAT GCAGGAAATT AAAATGATAT TGTGTTAGAC GGTCTAACAG AGTGATATCT CTTTTCATCA AAGGGCACAC
ATGACTTGAA CACACAGCAC AGAAAGAATG ACTAACATCA GATGGACACC TTACAAACAC AATTTCAGTC AATGCCTAGG
TACTTACTTT CTCTGATCCC GCTTACAGCT CTGCGCACTA TTTTTTTTCT ACAAAATAGC CCAGAAATCA ACAGTAATGA
ATTTCATACA TGATCTTGGT AGGGTCAGTC GGGAAGACAA GCTGAGTTTC TTGTCCTTTA TATCACCCAC AAACACAAGC
CACCCCCAAT CATCCAGAAC TAGTTGGAAT TTGGAAACCG GGCAATCCAT CCAATCCCAA ATATCCCCAA TTGAGGTAGG
TGATCTAGCA TGATGTATGC TCAACTGACC ATGAACTTTG CTAGCACACA TTTTCAAAAT GTTTCTCAGG ACACTCACCG
AACTTGCAAT TCTGGGAACT CTTCTAACAT GAGTTATCTT TAGTCAAAAT ATTTCTGCAC AGCAGCCACG AGTTTTTTTT
TTCCTCTAAG GCTGGTTGCT TAGTCTCCCA GCAGATGTAA AGAATAAAGA CGGCCATATA CATAGCTTTT GTTAATCTCC
TTTTGTCTTT CTAGAGCATC AGTAGATGCA TATGTATCCA CATCTTGCTT TAAGTAGCCG TAATTTCACA GTTCCATCTA
CAAGATCTCC TTCTGAAATG AATGCAATGG CTAACACCTC AAAAACTTTA GCCACTGAAA CTTTTTGACT AAAAGTGAGA
TCATAAAGCC TAGTAAACTA TTTTGCCAAA GAGCTATCTC CCAGCCAAAC ATCATCCGAG AAATGTGCAT GTTCTCTGTT
ACCAATTATT TTATTGCAGA ATGATAACAA AATGTCTTTG ACAACTATCA ATCCTGCGca gaaatttgaa tctgactgtt
ttggtttcaa tagctatgga ggaatttttg cctgaatgct tagaccttag taattcctgc caaggtcctc catggttctc
caatttccat agccacttcg ataaaaggca gatattcatg aggtataaat caagtatgcc tagtccacat tatgtttttt
ggtgacaaac cactggctac tttacaatac ggtaatttct tgtatcttct tgccataaaa gcctagatct aaaaacatca
tttttttttg caagggacct tcaacacacc tttcagaatg ctaaaaagtg aaatcatata agaaggaaca ttactaatac
atgaatcaag taaaactaac ctgccaccaa ttggcaactt cttaccctgc taattgttta atttcttttc aaccttttcc
tctacccctt tcaaaccact gttcctttat ttcttttgtt atgaatgggg atacccaaat atttaaatgg caatattccc
ttctgacagg tgaaagtcag agcataatca tcctgtagtt ttcgcctctg taaaacaata cactgcactc tgatgagaat
taatcttaat acactgtttt gctcaaacaa acaaatgata aatatcacat ttctagactc taacaaacta tcatccaatg
agaaaatagt gtcatcagca tattgtaaaa tttccaagga ctcattacat aaatatcacg tgaagcgact tagaatacct
tgttcttgag ctctcttaac caGAAACTTA TTTTTTTTCT CCTGCGACTA AATTTGTAGA GTTCTATAAT TTCTGATGAG
GCCTTTCAAA TGATTAACTT CGGGTGAATT CCTATTTCTC CTACCCTTGG TTTCACACAG ACTACATCTG GTCTTTTTCT
TAAAGAGACC ATAAAGGTAT TTTCTATCTC GAGAAAAAAT AATCTATAGT TTCCTCGTCT TTGAGGATAC AAGGTTTGTA
CTATCCTAGG AGGATTAATC AGCACTCTCC TGTACTGATC CCTCCCTAGT CTGCTCTTTG TCCTTGGATT TGATGCTACC
AATATACATT TCACACTTTG GTTGTTCCAG GCCTTCAATA ACCCATTATT CCTCCTTTGT GCTGCCCAAC GTTACGCCCA
ATTGCAATGC AATACTGCTA AGTACCTCTT CAAAGAATTA AGTACTGTAG GTCATATGTT TGCCTTCCAG TTTCTCATTC
CAAATCTATG TGTTTCACTA AGTCGGATCA ATATCATGTA CTGGAGCAAG AAGAATGATT GGAAGCATAA ATAGGTACCA
AGTTTGTCTA ATCAGGAATT AGTTTTACTT GGTAGTTGGT ACATCCGAAC TATTGGTGTG CTCTGTGCAC TCATCAACTA
GATTACTTAA AATGCTTTCT TTTATTATGT GGATGGTTCA GCTATGAGAC ATTTAGCTTT ATTTTTGAGT TATTTATATA
GTTAATATCA ATTATTATTT GCTCTTATCA CCAATATTAT TAGTTTCTAT TCTAATTTCT ATGCATGGTA CAAGGTTTGA
CTTTTGCTCA AATATGCTTA AAACTCTCCA GAGTTATGGC TTGTTTTTTC ACCGTAGAGT TGCTATGGCT ACTTTTTTTC
ACTTGAGGGT GCTCATAATT ATTTCCATCC GAGCGTGCAT ATATGGTTGT AATTTGTTCT AGAACATTTT GTTATAAAGT
TCATTTCATG ATTGAATTAG CCTCTGAGCT TAATAGTGAC ATTGTAATCT TGCAGTCTGT TCAGTTAAGC ACTGTCAATG
CATGGAGACA TTCTCAGGTA CCAATCTACT ACACAGTCAG TGCACATGGA GAGCTCATTA ATTCAACATT TTCTTGCTTT
ACTTGATCTT GCAGAGCTAT TCAAGGGACC AGAAATTAGC ATTGATGGAA ATATTCGATG TTCTGCAAGC TGTTTGTCAA
GCACACTTGC TACCTTTGGC ACTTGCATGG ATTCCAGTTT GCTCCAAAAG AGATGTGCTT GTGTCAGTAG AATATGGTGC
AAATTTTGGT AAAAGGAACA AAGAAGTGCT TTGCATAGAG GAATCTGCAT GTTATGTCAA TGACACGAGA ATGCGTGATT
TTGTCCAAGT CTGTGCTGAA CACCCCCTTG AGAAAGGACA AGGTGTCGCT GGAAATGCAT ATTTATCAAA TAATCCCTTC
TTCTCATCTG ATGTGAAGGA TTATGATATG CACGCTTATC CACTTGTCAA TCATGCCCGT AAATTTGGTC TTCATGCTGC
TGTTGCAATT AGGCTGCAGA GCACATACAC CAAAAATGAT GACTATGTGC TTGAGTTTTT TCTTCCAGTC TTGTGCAAAG
GTGGTGGAGA ACAACAGCTC TTACTTGACA GCATATCTGC GACTATGCGG AGAGTATGCA AAAGTCTGAG AACTGTTTCA
GATGCTGAGT TGAAGGAAGA TGTTACAAGA AAGCCATCAA ATGAAAATCG ATCAGGAACA AGATGCCCTT CACCTGTTAA
CCTTATTTAT TCAGGCCGAG AAATTGATGT ATCGAATGAA ACAAAAACAA ATACGCCTTT GGAATATCAG ATAGAGGGCA
TTGATGAACA ACTATCAGAT ACAAAAAGTA CTAACAAGGT TGTTTCATCC TCAACATTCT CACTATGTGC TTTCATCCTC
TCTTATCTGT CGTGTGGTCT GTTTTTCTTT GTGTGCTTTA GTCATTCAGA CATGAACAAT TGGAAGTGAT AACTCTGCAG
GATAGTTTTT TCAGTAAATT GTTTGAATAG TTCCTT