Os11t0293800-00

Locus

Os11g0293800

Description

Similar to ZCN17.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

FTL11

CGSNL Gene Name

FLOWERING TIME LIKE GENE 11

Oryzabase Gene Symbol Synonym(s)

OsFTL11

Oryzabase Gene Name Synonym(s)

FT-like gene 11

Transcript Evidence

AK367970 (DDBJ)

Protein Evidence

A9LLZ1 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Phosphatidylethanolamine-binding, conserved site (IPR001858)

Phosphatidylethanolamine-binding protein PEBP (IPR008914)

Expression Databases

TENOR (Os11t0293800-00)

Others

Oryzabase (11232)

Transcript

642 bp

>Os11t0293800-00 Similar to ZCN17.
AGCTCTCATCCTAGCTAAGCTATCTCATCTCACAGCAAGCTCTAGCTACTGATCTCCAGC
TGATCCTCAGTTTCTCCCCCAATCATATTCTGTGATCAACATGTCTAGGGACCCATTGGT
TGTCGGTCATGTCGTCGGCGATATCGTGGACCCGTTCGTCACCACCGCTTCGCTTAGGGT
CTTCTACAACAGCAAGGAGATGACAAATGGGTCTGAGCTCAAGCCATCTCAGGTGTTGAA
CCAACCAAGGATTTATATCGAAGGTCGCGACATGAGGACGCTCTACACGCTTGTAATGGT
GGACCCTGATGCACCAAGCCCCAGCAACCCTACTAAAAGAGAGTACCTTCATTGGATGGT
GACAGACATTCCAGAGACCACTGATGCCAGATTTGGTAATGAGATTGTCCCCTATGAGAG
CCCACGCCCAACTGCAGGCATCCATCGCTTCGTGTTCATCCTATTCAGGCAGTCAGTCAG
GCAGACCACCTATGCACCAGGGTGGCGCCAAAACTTCAATACAAGGGACTTTGCTGAGCT
CTACAACCTCGGTTCGCCGGTCGCCGCGCTCTTCTTCAACTGCCAGAGGGAGAACGGCTG
TGGAGGAAGAAGGTGTGTTAGATGATATATGTATAAATTGTT

CDS

573 bp

>Os11t0293800-00 Similar to ZCN17.
TCTCCAGCTGATCCTCAGTTTCTCCCCCAATCATATTCTGTGATCAACATGTCTAGGGAC
CCATTGGTTGTCGGTCATGTCGTCGGCGATATCGTGGACCCGTTCGTCACCACCGCTTCG
CTTAGGGTCTTCTACAACAGCAAGGAGATGACAAATGGGTCTGAGCTCAAGCCATCTCAG
GTGTTGAACCAACCAAGGATTTATATCGAAGGTCGCGACATGAGGACGCTCTACACGCTT
GTAATGGTGGACCCTGATGCACCAAGCCCCAGCAACCCTACTAAAAGAGAGTACCTTCAT
TGGATGGTGACAGACATTCCAGAGACCACTGATGCCAGATTTGGTAATGAGATTGTCCCC
TATGAGAGCCCACGCCCAACTGCAGGCATCCATCGCTTCGTGTTCATCCTATTCAGGCAG
TCAGTCAGGCAGACCACCTATGCACCAGGGTGGCGCCAAAACTTCAATACAAGGGACTTT
GCTGAGCTCTACAACCTCGGTTCGCCGGTCGCCGCGCTCTTCTTCAACTGCCAGAGGGAG
AACGGCTGTGGAGGAAGAAGGTGTGTTAGATGA

Protein

191 aa

>Os11t0293800-00 Similar to ZCN17.
SPADPQFLPQSYSVINMSRDPLVVGHVVGDIVDPFVTTASLRVFYNSKEMTNGSELKPSQ
VLNQPRIYIEGRDMRTLYTLVMVDPDAPSPSNPTKREYLHWMVTDIPETTDARFGNEIVP
YESPRPTAGIHRFVFILFRQSVRQTTYAPGWRQNFNTRDFAELYNLGSPVAALFFNCQRE
NGCGGRRCVR*

5'UTR

chr11:10732822..10732873 (+ strand) : 52 bp

CDS

chr11:10732874..10733113 (+ strand) : 240 bp

chr11:10733778..10733839 (+ strand) : 62 bp

chr11:10734043..10734083 (+ strand) : 41 bp

chr11:10734569..10734798 (+ strand) : 230 bp

3'UTR

chr11:10734799..10734815 (+ strand) : 17 bp

FASTA

>Os11t0293800-00 class=Sequence position=chr11:10732822..10734815 (+ strand)
AGCTCTCATC CTAGCTAAGC TATCTCATCT CACAGCAAGC TCTAGCTACT GATCTCCAGC TGATCCTCAG TTTCTCCCCC
AATCATATTC TGTGATCAAC ATGTCTAGGG ACCCATTGGT TGTCGGTCAT GTCGTCGGCG ATATCGTGGA CCCGTTCGTC
ACCACCGCTT CGCTTAGGGT CTTCTACAAC AGCAAGGAGA TGACAAATGG GTCTGAGCTC AAGCCATCTC AGGTGTTGAA
CCAACCAAGG ATTTATATCG AAGGTCGCGA CATGAGGACG CTCTACACGC TTGTAAGTGT GATACATAGT TCGGTTGAAG
TTGTTGCTAC AATAGGTTCA TCTTTCTTGA AATCATTGGC CTTCTATGGT TTATTAGGCT TTGTCTCTTT TTTTCTTTAT
AAAACTTGAA TTTTGAGTAG TCCTAATTAA TGGATATAAT TGGCATCTCT CTAGCTTGAC TATTTACTGG AACCAACCCA
GCATATTGCC TAAATAAAGT GTCCACTATA TTCCCTGATA TTATAAGATG GAAATAAAAG CATATGTCAT TCAGTTGACG
TCTTTAGTTC ATGTGCATGT TTTGTTAATA TGTCCTTTAG TAGACAATAC TAACTAATCC GTCCTCTTAG TATTGGTAAA
TTGCAATGTT TTAGATCACA TCCACTGACT ACACACACAC ACACACACAC ACTACCCTTT GCCCAATCAC CAAAATTATT
TCTGGTATTA ATTCAACTCC TATGTATCAA TTTCCTTGTG ATATTTACTT GTTTTTTTTG TATATGCATG CTCCCATATA
AGAATTATTG TATATGCTCA ACAATGATCA AAACATATTT ATGCACACAA CATGAGCTTG TCATAGACTT TATGAGTGCT
CATTCTATGA GAATATCTAG AGTGTTTGAG AGATTCATCT CACATGTGTC TACACATCTA TATATCTTGT TGCTAGGTAA
TGGTGGACCC TGATGCACCA AGCCCCAGCA ACCCTACTAA AAGAGAGTAC CTTCATTGGT AAGCTCCATG TAGCTTTTAT
GTGCATGCGT TTGAGTGGCA ATCCACAGGC CCTTTATTTC CCCCCTTCAC TTTATTTACA TGCATGCATG CATGCGGTGT
GCTGCTCCTG TTGTTGATAG ATGCATGCAT GAGTATAATA TTTATATCAT CTTGACATAG TACTGATTTG TTAGTTCTCA
ATATCTGATG CAAAAATATA GGATGGTGAC AGACATTCCA GAGACCACTG ATGCCAGATT TGGTAAGTGA TTTGACTCTT
GTTAATGCCA TTTTATCTGC ATGTCATGTG ACTTCTCTGT CCTATGTTCA AGTTGTTCAA GCTACCTAAT CAAATATTTT
GGTTTTCGGC GCCGACAAAA GCTAAAGTGT CTCTAAGGGT TTCTTTTTGC CACACAAATA AATTAATAGG TGTACAGTTA
AACAGTGGCA TGAAAAGAGA ACATGATTCC TATCTTCGAT TATATTGTGC TTCATAGAAA CTAATTAAAC ATGGTATATA
TCATGTGCTG CACACATTTG ATCCATGTTT GGAAAGATGA AAAATAATAT ATTACTTCCA CAAATATATT AGATTGAGTT
ATCTGCTTTG TAACATTAAC TTAAATTTTT CATTCATCTA AGTTATAACA TAACCTAAAT TTTTCATTCA TCTAAGTTTA
TAACATCTTT TAGCATAAAA TCTTCACCAC TACAGAAATT AAATGTTGAT ATTGTATGTG TCATCAGGTA ATGAGATTGT
CCCCTATGAG AGCCCACGCC CAACTGCAGG CATCCATCGC TTCGTGTTCA TCCTATTCAG GCAGTCAGTC AGGCAGACCA
CCTATGCACC AGGGTGGCGC CAAAACTTCA ATACAAGGGA CTTTGCTGAG CTCTACAACC TCGGTTCGCC GGTCGCCGCG
CTCTTCTTCA ACTGCCAGAG GGAGAACGGC TGTGGAGGAA GAAGGTGTGT TAGATGATAT ATGTATAAAT TGTT

Locus: Os11g0293800

Loading...

Locus: Os11g0293800

Loading...