Os11t0427800-01

Locus

Os11g0427800

Description

Similar to Lipid transfer protein LPT III.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.14, OsLtpI.14

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.14, lipid transfer protein 1.14, type 1 non-specific lipid transfer protein 14, Non-specific lipid-transfer protein 1

Transcript Evidence

AK061288 (DDBJ, Best hit)

AK071260 (DDBJ, Best hit)

Protein Evidence

A2ZDR8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

006-212-H12 (Online Clone Ordering)

J023086A05 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0427800-01)

Others

Oryzabase (13523)

Transcript

846 bp

>Os11t0427800-01 Similar to Lipid transfer protein LPT III.
ATTCATCCTAGCTCTCGCAGCAGCAACCAGCAAGGTAATTAACCAACACCGAGCATCAAG
CGCAGTAGCCAAGTCAGCTGAGCTCAGCTAGCTAGCATCCTCTGGATCGATCGAGATGGC
CCGTGCACAGTTGGTGTTGGTCGCCGTGGTGGCAGCTCTGCTCCTCGCCGCCCCGCACGC
CGCCGTGGCCATCACCTGCGGCCAGGTGAACTCAGCCGTTGGCCCCTGCCTCACCTACGC
CCGCGGCGGCGGCGCCGGCCCTTCCGCGGCCTGCTGCAACGGCGTGAGGAGCCTCAAGTC
CGCTGCCAGAACCACCGCTGACCGGCGCACCGCCTGCAACTGCCTCAAGAACGCCGCCCG
TGGCATCAAGGGGCTCAACGCCGGCAACGCCGCCAGCATCCCCTCCAAGTGCGGCGTCAG
CGTCCCCTACACCATCAGCGCTTCCATCGACTGCTCTAGGGTGAGGTGATCGAGCTATAT
CGATCGGATCGATGATCATATATATACAGCAGCGCGCCGGTTGCCACCTGGGTCGATGTG
TGTGGAGCCGAATTCTGTATCCAATACTACTAGTAGTATCTGTATTCTGGAATAAAAGAT
GAGCTAGCTAGGTCCATCGATCACCATGCATGCATGTGTGTATGGTTATTGATCGGCCCG
GTCAGTCCAGCTAGCTTCCTGTTATGTGTGTTCGTCTCGTTTAATTTGCTCCTTTTTGAG
GTGTACGTACCAGTGAGAGCTAGAGATTGAGTTTATACCCATCTACATGCATGTGCGTGC
TACTAGCTCCTTGTACTACGTGCTTGTTTGGATTATTACACATACATGTAGCTCTTTTTG
GTACAC

CDS

354 bp

>Os11t0427800-01 Similar to Lipid transfer protein LPT III.
ATGGCCCGTGCACAGTTGGTGTTGGTCGCCGTGGTGGCAGCTCTGCTCCTCGCCGCCCCG
CACGCCGCCGTGGCCATCACCTGCGGCCAGGTGAACTCAGCCGTTGGCCCCTGCCTCACC
TACGCCCGCGGCGGCGGCGCCGGCCCTTCCGCGGCCTGCTGCAACGGCGTGAGGAGCCTC
AAGTCCGCTGCCAGAACCACCGCTGACCGGCGCACCGCCTGCAACTGCCTCAAGAACGCC
GCCCGTGGCATCAAGGGGCTCAACGCCGGCAACGCCGCCAGCATCCCCTCCAAGTGCGGC
GTCAGCGTCCCCTACACCATCAGCGCTTCCATCGACTGCTCTAGGGTGAGGTGA

Protein

118 aa

>Os11t0427800-01 Similar to Lipid transfer protein LPT III.
MARAQLVLVAVVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGGAGPSAACCNGVRSL
KSAARTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVR*

5'UTR

chr11:13668526..13668640 (+ strand) : 115 bp

CDS

chr11:13668641..13668984 (+ strand) : 344 bp

chr11:13669101..13669110 (+ strand) : 10 bp

3'UTR

chr11:13669111..13669487 (+ strand) : 377 bp

FASTA

>Os11t0427800-01 class=Sequence position=chr11:13668526..13669487 (+ strand)
ATTCATCCTA GCTCTCGCAG CAGCAACCAG CAAGGTAATT AACCAACACC GAGCATCAAG CGCAGTAGCC AAGTCAGCTG
AGCTCAGCTA GCTAGCATCC TCTGGATCGA TCGAGATGGC CCGTGCACAG TTGGTGTTGG TCGCCGTGGT GGCAGCTCTG
CTCCTCGCCG CCCCGCACGC CGCCGTGGCC ATCACCTGCG GCCAGGTGAA CTCAGCCGTT GGCCCCTGCC TCACCTACGC
CCGCGGCGGC GGCGCCGGCC CTTCCGCGGC CTGCTGCAAC GGCGTGAGGA GCCTCAAGTC CGCTGCCAGA ACCACCGCTG
ACCGGCGCAC CGCCTGCAAC TGCCTCAAGA ACGCCGCCCG TGGCATCAAG GGGCTCAACG CCGGCAACGC CGCCAGCATC
CCCTCCAAGT GCGGCGTCAG CGTCCCCTAC ACCATCAGCG CTTCCATCGA CTGCTCTAGG TAATTAATCA TCTAATCCTA
TATATTCCGT TAAATATATA TAATTACGCA TGGCTTTGTA TGATAATTAA GTATCTATAT CATCTAATCT ATATATATGT
ACTGTGCGTG TGCAGGGTGA GGTGATCGAG CTATATCGAT CGGATCGATG ATCATATATA TACAGCAGCG CGCCGGTTGC
CACCTGGGTC GATGTGTGTG GAGCCGAATT CTGTATCCAA TACTACTAGT AGTATCTGTA TTCTGGAATA AAAGATGAGC
TAGCTAGGTC CATCGATCAC CATGCATGCA TGTGTGTATG GTTATTGATC GGCCCGGTCA GTCCAGCTAG CTTCCTGTTA
TGTGTGTTCG TCTCGTTTAA TTTGCTCCTT TTTGAGGTGT ACGTACCAGT GAGAGCTAGA GATTGAGTTT ATACCCATCT
ACATGCATGT GCGTGCTACT AGCTCCTTGT ACTACGTGCT TGTTTGGATT ATTACACATA CATGTAGCTC TTTTTGGTAC
AC

Locus: Os11g0427800

Loading...

Locus: Os11g0427800

Loading...