Os11t0454000-01

Locus

Os11g0454000

Description

Dehydrin RAB 16C.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAB16C

CGSNL Gene Name

RESPONSIVE TO ABA GENE 16C

Oryzabase Gene Symbol Synonym(s)

rab21, OsLEA27, rab16C, OsRAB16C, DHD

Oryzabase Gene Name Synonym(s)

RAB(RESPONSIVE TO ABA) GENE 16C, Dehydrin Rab16C, late embryogenesis abundant protein 27

Transcript Evidence

AK071366 (DDBJ, Best hit)

Protein Evidence

Q2R4Z7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: response to stress (GO:0006950)

Biological Process: response to water (GO:0009415)

Functional domain (InterPro)

Dehydrin (IPR000167)

Full-length cDNA

J023096D05 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0454000-01)

RiceXPro (AK071366)

Others

Oryzabase (8413)

KEGG (Os11t0454000-01)

Transcript

794 bp

>Os11t0454000-01 Dehydrin RAB 16C.
ATCGATCACAAGACACAAGATTTTTCACTGATAGAATAGCAACACTTGGGTGAGAGATCA
GACGCGTGTTTGAGAAGATGGAGAACTACCAGGGGCAGCACGGCTACGGCGCCGACCGCG
TCGACGTGTACGGCAACCCGGTCGCCGGCCAGTACGGCGGCGGCGCCACCGCTCCCGGCG
GAGGCCATGGCGTGATGGGAATGGGAGGGCATCACGCCGGCGCCGGCGGGCAGTTCCAGC
CGGTGAAGGAGGAGCACAAGACCGGCGGCATCCTCCACCGCTCCGGCAGCTCAAGCTCCA
GCTCGTCGTCTGAGGACGACGGGATGggagggaggaggaagaagggaatcaaggagaaga
tcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatgg
ggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccg
gcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggaca
agatcaaggaaaagcttcccggCCAGCACTAAATAAGCTCGACCGGGTCGTCACCAAATA
TGTCGTGATGTACGTGCAGTTTTATATGTTGTTGAATAAACTAGCGTGAAATGCGAGTGA
TGGTGTCTTCTGCCTTGGGACGGATGACACATTGTCTGTTGTGTTCTCGCGTCCGTGTCG
GTTTTACCCTTGAAATGTAATATGGTGTGTGTACACACTAAGGTTTTATTGAAGTGTGAC
TTTGTGCTTGTGTT

CDS

495 bp

>Os11t0454000-01 Dehydrin RAB 16C.
ATGGAGAACTACCAGGGGCAGCACGGCTACGGCGCCGACCGCGTCGACGTGTACGGCAAC
CCGGTCGCCGGCCAGTACGGCGGCGGCGCCACCGCTCCCGGCGGAGGCCATGGCGTGATG
GGAATGGGAGGGCATCACGCCGGCGCCGGCGGGCAGTTCCAGCCGGTGAAGGAGGAGCAC
AAGACCGGCGGCATCCTCCACCGCTCCGGCAGCTCAAGCTCCAGCTCGTCGTCTGAGGAC
GACGGGATGggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctcccc
ggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcg
tacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggt
gcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagctt
cccggCCAGCACTAA

Protein

164 aa

>Os11t0454000-01 Dehydrin RAB 16C.
MENYQGQHGYGADRVDVYGNPVAGQYGGGATAPGGGHGVMGMGGHHAGAGGQFQPVKEEH
KTGGILHRSGSSSSSSSSEDDGMGGRRKKGIKEKIKEKLPGGNKGNNQQQQQMMGNTGGA
YGQQGHAGMTGAGTGTGVHGAEYGNTGEKKGFMDKIKEKLPGQH*

5'UTR

chr11:15328581..15328657 (- strand) : 77 bp

CDS

chr11:15328353..15328580 (- strand) : 228 bp

chr11:15327991..15328257 (- strand) : 267 bp

3'UTR

chr11:15327769..15327990 (- strand) : 222 bp

FASTA

>Os11t0454000-01 class=Sequence position=chr11:15327769..15328657 (- strand)
ATCGATCACA AGACACAAGA TTTTTCACTG ATAGAATAGC AACACTTGGG TGAGAGATCA GACGCGTGTT TGAGAAGATG
GAGAACTACC AGGGGCAGCA CGGCTACGGC GCCGACCGCG TCGACGTGTA CGGCAACCCG GTCGCCGGCC AGTACGGCGG
CGGCGCCACC GCTCCCGGCG GAGGCCATGG CGTGATGGGA ATGGGAGGGC ATCACGCCGG CGCCGGCGGG CAGTTCCAGC
CGGTGAAGGA GGAGCACAAG ACCGGCGGCA TCCTCCACCG CTCCGGCAGC TCAAGCTCCA GCTCGGTACG TTCACTGTCG
TCCATTCATA AATCTAATTA ATCGCCTCGC TTCTGAATTC CTTTATTTAA TTTGAGTTGT ACTCGTGTGC GTTTGTGCAG
TCGTCTGAGG ACGACGGGAT Gggagggagg aggaagaagg gaatcaagga gaagatcaag gagaagctcc ccggcggcaa
caagggcaac aaccagcagc agcagcagat gatggggaac accggcggcg cgtacgggca gcaggggcac gccgggatga
ccggcgccgg caccggcacc ggcgtgcacg gtgcggagta cggcaacacc ggcgagaaga agggcttcat ggacaagatc
aaggaaaagc ttcccggCCA GCACTAAATA AGCTCGACCG GGTCGTCACC AAATATGTCG TGATGTACGT GCAGTTTTAT
ATGTTGTTGA ATAAACTAGC GTGAAATGCG AGTGATGGTG TCTTCTGCCT TGGGACGGAT GACACATTGT CTGTTGTGTT
CTCGCGTCCG TGTCGGTTTT ACCCTTGAAA TGTAATATGG TGTGTGTACA CACTAAGGTT TTATTGAAGT GTGACTTTGT
GCTTGTGTT

Locus: Os11g0454000

Loading...

Locus: Os11g0454000

Loading...