Os11t0454300-01

Locus

Os11g0454300

Description

Similar to Water-stress inducible protein RAB21.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAB16A

CGSNL Gene Name

RESPONSIVE TO ABA GENE 16A

Oryzabase Gene Symbol Synonym(s)

Rab16A, rab21, RAB21, OsRab21, OsRAB21, OsRab16A, OsLEA29, rab16A, OsRAB16A

Oryzabase Gene Name Synonym(s)

RAB(responsive to ABA) gene 16A, RAB gene 16A, late embryogenesis abundant protein 29, responsive to ABA protein 21

Transcript Evidence

AK121952 (DDBJ, Best hit)

Protein Evidence

Q2R4Z4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: response to stress (GO:0006950)

Biological Process: response to water (GO:0009415)

Functional domain (InterPro)

Dehydrin (IPR000167)

Full-length cDNA

J033107K14 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0454300-01)

RiceXPro (AK121952)

Others

Oryzabase (6385)

KEGG (Os11t0454300-01)

Transcript

708 bp

>Os11t0454300-01 Similar to Water-stress inducible protein RAB21.
GCACACCACAGCAAGAGCTAAGTGAGCTAGCCACTGATCAGAAGAACACCTCGATCTCCG
AGAGTTTTTTTTCAGCTTTAGCTTAAGCAGGATGGAGCACCAGGGGCAGCACGGCCACGT
GACCAGCCGCGTCGACGAGTACGGCAACCCGGTCGGCACCGGCGCCGGACACGGCCAGAT
GGGCACCGCCGGCATGGGGACGCACGGCACCACCGGCGGCATGGGAACGCACGGCACCAC
CGGCGGCATGGGGACGCACGGCACCACCGGCACCGGCGGCGGCCAGTTCCAGCCGATGAG
GGAGGAGCACAAGACCGGCGGCGTCCTGCAACGCTCCGGCAGCTCCAGCTCAAGCTCGTC
TGAGGATGATGGAATGggagggaggaggaagaaggggatcaaggagaagatcaaggagaa
gctccccggcggcaacaagggcgagcagcagcatgccatgggcggcaccggcggcgccta
cgggcagcagggccacggcaccgggatgaccaccggcaccaccggcgcacacggcaccac
caccaccgacaccggcgagaagaagggcatcatggacaagatcaaggagaagctgcccgg
ccagcactgagctcgacacaccaccacaccatgtgtctgcgccgccggcgaCGGCCGCCA
CGTCACCTTCCTGAATAATAAGATGAGCTAGCCGAGCGCAATAAAAGG

CDS

519 bp

>Os11t0454300-01 Similar to Water-stress inducible protein RAB21.
ATGGAGCACCAGGGGCAGCACGGCCACGTGACCAGCCGCGTCGACGAGTACGGCAACCCG
GTCGGCACCGGCGCCGGACACGGCCAGATGGGCACCGCCGGCATGGGGACGCACGGCACC
ACCGGCGGCATGGGAACGCACGGCACCACCGGCGGCATGGGGACGCACGGCACCACCGGC
ACCGGCGGCGGCCAGTTCCAGCCGATGAGGGAGGAGCACAAGACCGGCGGCGTCCTGCAA
CGCTCCGGCAGCTCCAGCTCAAGCTCGTCTGAGGATGATGGAATGggagggaggaggaag
aaggggatcaaggagaagatcaaggagaagctccccggcggcaacaagggcgagcagcag
catgccatgggcggcaccggcggcgcctacgggcagcagggccacggcaccgggatgacc
accggcaccaccggcgcacacggcaccaccaccaccgacaccggcgagaagaagggcatc
atggacaagatcaaggagaagctgcccggccagcactga

Protein

173 aa

>Os11t0454300-01 Similar to Water-stress inducible protein RAB21.
MEHQGQHGHVTSRVDEYGNPVGTGAGHGQMGTAGMGTHGTTGGMGTHGTTGGMGTHGTTG
TGGGQFQPMREEHKTGGVLQRSGSSSSSSSEDDGMGGRRKKGIKEKIKEKLPGGNKGEQQ
HAMGGTGGAYGQQGHGTGMTTGTTGAHGTTTTDTGEKKGIMDKIKEKLPGQH*

5'UTR

chr11:15343581..15343671 (- strand) : 91 bp

CDS

chr11:15343314..15343580 (- strand) : 267 bp

chr11:15342975..15343226 (- strand) : 252 bp

3'UTR

chr11:15342877..15342974 (- strand) : 98 bp

FASTA

>Os11t0454300-01 class=Sequence position=chr11:15342877..15343671 (- strand)
GCACACCACA GCAAGAGCTA AGTGAGCTAG CCACTGATCA GAAGAACACC TCGATCTCCG AGAGTTTTTT TTCAGCTTTA
GCTTAAGCAG GATGGAGCAC CAGGGGCAGC ACGGCCACGT GACCAGCCGC GTCGACGAGT ACGGCAACCC GGTCGGCACC
GGCGCCGGAC ACGGCCAGAT GGGCACCGCC GGCATGGGGA CGCACGGCAC CACCGGCGGC ATGGGAACGC ACGGCACCAC
CGGCGGCATG GGGACGCACG GCACCACCGG CACCGGCGGC GGCCAGTTCC AGCCGATGAG GGAGGAGCAC AAGACCGGCG
GCGTCCTGCA ACGCTCCGGC AGCTCCAGCT CAAGCTCGGT ACAAACATTT TGCCCCCAAT TCTTTACCCC CCCAGTAAAA
CCTTGCGTAC AAATTCGTTG AAAAATTTTA ATGTCTTTGT GACAGTCTGA GGATGATGGA ATGggaggga ggaggaagaa
ggggatcaag gagaagatca aggagaagct ccccggcggc aacaagggcg agcagcagca tgccatgggc ggcaccggcg
gcgcctacgg gcagcagggc cacggcaccg ggatgaccac cggcaccacc ggcgcacacg gcaccaccac caccgacacc
ggcgagaaga agggcatcat ggacaagatc aaggagaagc tgcccggcca gcactgagct cgacacacca ccacaccatg
tgtctgcgcc gccggcgaCG GCCGCCACGT CACCTTCCTG AATAATAAGA TGAGCTAGCC GAGCGCAATA AAAGG