Os11t0484300-01

Locus

Os11g0484300

Description

Similar to Mcm2-prov protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MCM2

CGSNL Gene Name

MINI-CHROMOSOME MAINTENANCE PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsMCM2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK121422 (DDBJ, Best hit)

Protein Evidence

Q6QNH2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Biological Process: DNA-dependent DNA replication initiation (GO:0006270)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Mini-chromosome maintenance, DNA-dependent ATPase (IPR001208)

Mini-chromosome maintenance complex protein 2 (IPR008045)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Mini-chromosome maintenance, conserved site (IPR018525)

Full-length cDNA

J023133N01 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0484300-01)

RiceXPro (AK121422)

Others

Oryzabase (9202)

KEGG (Os11t0484300-01)

Transcript

3213 bp

>Os11t0484300-01 Similar to Mcm2-prov protein.
AGCAGCCACTCCTCCCCACCTTACTCCCCCCCGCTTCCACTCCCCCGAACCTTCCAGAAC
CTTCTCCCGCTCCCCCGCCGAGATGGATGACTCGGAGAACAACGCGCCGTCGACGCCGGG
GTCGCCGGGGTTCAGCACAGACAGGCTGCCGCCGAACACCACCACCAGCCGCGGCGCCAC
CGACCCGTCCTCCTACTCGGACGACGACGACGACGACGTGGTTGGCGCGGAGGAGGCGGA
GGTCGACCCCAACGTGCTCCCCGAGGACGACGGCGTCGTCGCCGCCGAGGAGGAGGAGGA
CGGGGAGGACCTCTTCAACGACAACTACCTCGATGATTACCGGAGGATGGATGAGCAGGA
CCAGTATGAATCGGTTGGGTTAGATGACTCGATAGAGGATGAAAGGAACCTGGATGAGAT
CATGGCAGATAGAAGGGCTGCTGAAGCAGAACTTGATGCAAGGGATGTGAGGACTGGTGC
AGCACCTGATAGGAAATTGCCACGGATGCTACATGATCAAGACACAGATGAGGATATGAG
CTTCAGGCGTCCTAAAAGGCACAGAGCTAATTTTAGACCACCAAGGGAACCAAGAACACC
AAGAAGTGATGATGACGGTGATGGTGCCACGCCTAGTTCACCTGGAAGATCTCAGCGTGG
AATGTATTCTGGAGGGGATGTACCTATGACTGACCAGACTGATGATGATCCATATGAGGA
TGAATTTGATGAAGAAGATGAGATGAACATGTACCGTGTACAAGGAACTCTTAGAGAGTG
GGTCACAAGAGATGAAGTCCGCCGCTTTATCGCAAAGAAGTTCAAAGAATTCCTTCTAAC
ATATGTAAACCCAAAGAATGAACAAGGAGAGTTTGAGTATGTTCGACTAATCAATGAGAT
GGTTCTAGCTAACAAATGCAGCTTAGAGATAGATTACAAGCAATTTATTTATATACATCC
AAACATTGCTATATGGTTGGCTGATGCACCTCAATCGGTGCTAGAAGTTATGGAGGAAGT
TGCCAAAAATGTTGTTTTTGATCTCCATAAGAACTATAGGAACATTCATCAAAAAATCTA
TGTCCGAATAACCAATCTTCCTGTCTACGACCAAATACGCAATATCAGGCAAATCCATCT
GAACACAATGATTCGAATTGGTGGTGTTGTTACTCGGAGATCAGGTGTTTTTCCTCAGCT
ACAACAGGTCAAGTTTGACTGCAGCAAATGTGGGACTGTCCTGGGCCCCTTCTTCCAGAA
CTCTTACACTGAAGTCAAGGTTGGATCCTGCCCTGAGTGCCAATCCAAAGGGCCATTCAC
CATCAATGTTGAGCAAACCATATATAGGAACTACCAGAAACTCACTCTTCAGGAAAGCCC
AGGAATTGTTCCTGCTGGCAGGCTTCCAAGATACAAGGAAGTGATACTTCTGAATGATTT
GATTGACTGTGCTCGACCAGGAGAGGAAATTGAGGTCACTGGGATATACACCAACAATTT
TGACTTGTCTTTGAATACAAAGAATGGTTTCCCAGTTTTTGCCACAGTAGTGGAGGCAAA
CTATGTGGCAAAAAAACAGGATCTGTTCTCTGCTTACAAATTAACTGATGAGGACAAGGC
GGAGATTGAGAAGTTGGCAAAAGATCCACGGATCGGTGAAAGGATTGTCAAATCAATTGC
ACCATCCATATATGGTCATGAAGATATCAAGACTGCCATTGCACTAGCTATGTTTGGGGG
GCAAGAGAAGAATGTCAAGGGAAAGCATCGCTTGAGAGGAGATATCAATGTACTCCTCTT
AGGTGATCCAGGCACTGCAAAATCCCAATTTCTCAAGTATGTTGAGAAAACTGGACACAG
AGCAGTGTACACAACTGGAAAAGGAGCTTCTGCTGTTGGACTCACCGCAGCAGTTCACAA
GGATCCAGTAACACGGGAATGGACACTTGAGGGTGGTGCACTAGTGCTTGCTGATAGAGG
CATATGCCTTATTGATGAATTTGATAAGATGAACGATCAAGATAGGGTGAGTATTCATGA
GGCCATGGAGCAACAAAGTATCAGTATATCAAAGGCCGGAATTGTCACATCCCTTCAAGC
TCGGTGCAGTGTTATTGCTGCAGCAAACCCAATAGGAGGAAGATATGATTCATCGAAGAC
ATTCACCCAGAATGTTGAACTGACGGATCCAATTATTTCACGTTTTGATGTCCTTTGTGT
TGTGAAGGACATTGTTGACCCATTTACAGATGAAATGCTTGCAAGGTTTGTTGTAGATAG
TCATGCAAGATCTCAACCCAAGGGTGCTAACCTTGAAGATAGGGTTCCAACTGATGTTGA
GGATGATCCATTGGCTGCTGCCAGACAAGCTGACCCAGATATCCTTTCTCAAGACATGCT
GAAGAAGTACATAACTTATGCCAAGTTGAACGTGTTTCCCAAAATTCATGATGCTGACCT
GGACAAGATTAGCCATGTTTACGCAGAACTTCGTCGTGAGTCATCTCATGGTCAAGGAGT
CCCTATTGCCGTAAGGCATATCGAATCCATTATTCGGATGTCAGAGGCACATGCAAGGAT
GCATTTGAGGAGCTACGTGTCTCAGGAAGATGTCGACATGGCTATCCGCGTCCTGCTTGA
CTCATTTATTTCAACTCAGAAGTTTGGTGTACAGAAAGCACTTCAAAAGAATTTCAGGAA
ATACATGACCTATAAGAAGGATTACAATGAGCTGCTCTTGCTTCTTCTGCGCACCCTGGT
CAAGGATGTGCTGCACTTCGAAGAAATCGTTTCAGGACCAACGACGCGCCTGACTCACAT
CGAGGTTAAAGTAGAGGACCTGAAGAACAAGGCCCAGGAGTACGAAATCTATGACCTGAG
ACCGTTCTTCTCCAGCGCCCACTTCAGGGACAACAACTTCGTCCTCGACGAAGGGCGGGG
GATCATCAGGCACCCTCTTGCTGCCTAACTACAGAAGATCATCTGTGACCCATCTGACAA
TGAACAATTTGAGCTACCTCATGGGATTATCAGACATAGTGTAATCATCAAATGGCAACT
CCTTTGTGCTTTTTAGAGACTGTTGCATGTTATCCAGCTGCATTTGGATAGGGTGTACCG
TGTGTACTTTCTTAACATTGTAATTCTGCAAGTATGGTAGAAAATGATAAATCTGTGTCA
ATCAATGTATCATTGTTTTGCATTATTGTTTTC

CDS

2886 bp

>Os11t0484300-01 Similar to Mcm2-prov protein.
ATGGATGACTCGGAGAACAACGCGCCGTCGACGCCGGGGTCGCCGGGGTTCAGCACAGAC
AGGCTGCCGCCGAACACCACCACCAGCCGCGGCGCCACCGACCCGTCCTCCTACTCGGAC
GACGACGACGACGACGTGGTTGGCGCGGAGGAGGCGGAGGTCGACCCCAACGTGCTCCCC
GAGGACGACGGCGTCGTCGCCGCCGAGGAGGAGGAGGACGGGGAGGACCTCTTCAACGAC
AACTACCTCGATGATTACCGGAGGATGGATGAGCAGGACCAGTATGAATCGGTTGGGTTA
GATGACTCGATAGAGGATGAAAGGAACCTGGATGAGATCATGGCAGATAGAAGGGCTGCT
GAAGCAGAACTTGATGCAAGGGATGTGAGGACTGGTGCAGCACCTGATAGGAAATTGCCA
CGGATGCTACATGATCAAGACACAGATGAGGATATGAGCTTCAGGCGTCCTAAAAGGCAC
AGAGCTAATTTTAGACCACCAAGGGAACCAAGAACACCAAGAAGTGATGATGACGGTGAT
GGTGCCACGCCTAGTTCACCTGGAAGATCTCAGCGTGGAATGTATTCTGGAGGGGATGTA
CCTATGACTGACCAGACTGATGATGATCCATATGAGGATGAATTTGATGAAGAAGATGAG
ATGAACATGTACCGTGTACAAGGAACTCTTAGAGAGTGGGTCACAAGAGATGAAGTCCGC
CGCTTTATCGCAAAGAAGTTCAAAGAATTCCTTCTAACATATGTAAACCCAAAGAATGAA
CAAGGAGAGTTTGAGTATGTTCGACTAATCAATGAGATGGTTCTAGCTAACAAATGCAGC
TTAGAGATAGATTACAAGCAATTTATTTATATACATCCAAACATTGCTATATGGTTGGCT
GATGCACCTCAATCGGTGCTAGAAGTTATGGAGGAAGTTGCCAAAAATGTTGTTTTTGAT
CTCCATAAGAACTATAGGAACATTCATCAAAAAATCTATGTCCGAATAACCAATCTTCCT
GTCTACGACCAAATACGCAATATCAGGCAAATCCATCTGAACACAATGATTCGAATTGGT
GGTGTTGTTACTCGGAGATCAGGTGTTTTTCCTCAGCTACAACAGGTCAAGTTTGACTGC
AGCAAATGTGGGACTGTCCTGGGCCCCTTCTTCCAGAACTCTTACACTGAAGTCAAGGTT
GGATCCTGCCCTGAGTGCCAATCCAAAGGGCCATTCACCATCAATGTTGAGCAAACCATA
TATAGGAACTACCAGAAACTCACTCTTCAGGAAAGCCCAGGAATTGTTCCTGCTGGCAGG
CTTCCAAGATACAAGGAAGTGATACTTCTGAATGATTTGATTGACTGTGCTCGACCAGGA
GAGGAAATTGAGGTCACTGGGATATACACCAACAATTTTGACTTGTCTTTGAATACAAAG
AATGGTTTCCCAGTTTTTGCCACAGTAGTGGAGGCAAACTATGTGGCAAAAAAACAGGAT
CTGTTCTCTGCTTACAAATTAACTGATGAGGACAAGGCGGAGATTGAGAAGTTGGCAAAA
GATCCACGGATCGGTGAAAGGATTGTCAAATCAATTGCACCATCCATATATGGTCATGAA
GATATCAAGACTGCCATTGCACTAGCTATGTTTGGGGGGCAAGAGAAGAATGTCAAGGGA
AAGCATCGCTTGAGAGGAGATATCAATGTACTCCTCTTAGGTGATCCAGGCACTGCAAAA
TCCCAATTTCTCAAGTATGTTGAGAAAACTGGACACAGAGCAGTGTACACAACTGGAAAA
GGAGCTTCTGCTGTTGGACTCACCGCAGCAGTTCACAAGGATCCAGTAACACGGGAATGG
ACACTTGAGGGTGGTGCACTAGTGCTTGCTGATAGAGGCATATGCCTTATTGATGAATTT
GATAAGATGAACGATCAAGATAGGGTGAGTATTCATGAGGCCATGGAGCAACAAAGTATC
AGTATATCAAAGGCCGGAATTGTCACATCCCTTCAAGCTCGGTGCAGTGTTATTGCTGCA
GCAAACCCAATAGGAGGAAGATATGATTCATCGAAGACATTCACCCAGAATGTTGAACTG
ACGGATCCAATTATTTCACGTTTTGATGTCCTTTGTGTTGTGAAGGACATTGTTGACCCA
TTTACAGATGAAATGCTTGCAAGGTTTGTTGTAGATAGTCATGCAAGATCTCAACCCAAG
GGTGCTAACCTTGAAGATAGGGTTCCAACTGATGTTGAGGATGATCCATTGGCTGCTGCC
AGACAAGCTGACCCAGATATCCTTTCTCAAGACATGCTGAAGAAGTACATAACTTATGCC
AAGTTGAACGTGTTTCCCAAAATTCATGATGCTGACCTGGACAAGATTAGCCATGTTTAC
GCAGAACTTCGTCGTGAGTCATCTCATGGTCAAGGAGTCCCTATTGCCGTAAGGCATATC
GAATCCATTATTCGGATGTCAGAGGCACATGCAAGGATGCATTTGAGGAGCTACGTGTCT
CAGGAAGATGTCGACATGGCTATCCGCGTCCTGCTTGACTCATTTATTTCAACTCAGAAG
TTTGGTGTACAGAAAGCACTTCAAAAGAATTTCAGGAAATACATGACCTATAAGAAGGAT
TACAATGAGCTGCTCTTGCTTCTTCTGCGCACCCTGGTCAAGGATGTGCTGCACTTCGAA
GAAATCGTTTCAGGACCAACGACGCGCCTGACTCACATCGAGGTTAAAGTAGAGGACCTG
AAGAACAAGGCCCAGGAGTACGAAATCTATGACCTGAGACCGTTCTTCTCCAGCGCCCAC
TTCAGGGACAACAACTTCGTCCTCGACGAAGGGCGGGGGATCATCAGGCACCCTCTTGCT
GCCTAA

Protein

962 aa

>Os11t0484300-01 Similar to Mcm2-prov protein.
MDDSENNAPSTPGSPGFSTDRLPPNTTTSRGATDPSSYSDDDDDDVVGAEEAEVDPNVLP
EDDGVVAAEEEEDGEDLFNDNYLDDYRRMDEQDQYESVGLDDSIEDERNLDEIMADRRAA
EAELDARDVRTGAAPDRKLPRMLHDQDTDEDMSFRRPKRHRANFRPPREPRTPRSDDDGD
GATPSSPGRSQRGMYSGGDVPMTDQTDDDPYEDEFDEEDEMNMYRVQGTLREWVTRDEVR
RFIAKKFKEFLLTYVNPKNEQGEFEYVRLINEMVLANKCSLEIDYKQFIYIHPNIAIWLA
DAPQSVLEVMEEVAKNVVFDLHKNYRNIHQKIYVRITNLPVYDQIRNIRQIHLNTMIRIG
GVVTRRSGVFPQLQQVKFDCSKCGTVLGPFFQNSYTEVKVGSCPECQSKGPFTINVEQTI
YRNYQKLTLQESPGIVPAGRLPRYKEVILLNDLIDCARPGEEIEVTGIYTNNFDLSLNTK
NGFPVFATVVEANYVAKKQDLFSAYKLTDEDKAEIEKLAKDPRIGERIVKSIAPSIYGHE
DIKTAIALAMFGGQEKNVKGKHRLRGDINVLLLGDPGTAKSQFLKYVEKTGHRAVYTTGK
GASAVGLTAAVHKDPVTREWTLEGGALVLADRGICLIDEFDKMNDQDRVSIHEAMEQQSI
SISKAGIVTSLQARCSVIAAANPIGGRYDSSKTFTQNVELTDPIISRFDVLCVVKDIVDP
FTDEMLARFVVDSHARSQPKGANLEDRVPTDVEDDPLAAARQADPDILSQDMLKKYITYA
KLNVFPKIHDADLDKISHVYAELRRESSHGQGVPIAVRHIESIIRMSEAHARMHLRSYVS
QEDVDMAIRVLLDSFISTQKFGVQKALQKNFRKYMTYKKDYNELLLLLLRTLVKDVLHFE
EIVSGPTTRLTHIEVKVEDLKNKAQEYEIYDLRPFFSSAHFRDNNFVLDEGRGIIRHPLA
A*

5'UTR

chr11:17046950..17047031 (+ strand) : 82 bp

CDS

chr11:17047032..17047034 (+ strand) : 3 bp

chr11:17047119..17047366 (+ strand) : 248 bp

chr11:17048080..17048267 (+ strand) : 188 bp

chr11:17048748..17048944 (+ strand) : 197 bp

chr11:17049034..17049223 (+ strand) : 190 bp

chr11:17049320..17049539 (+ strand) : 220 bp

chr11:17049624..17049831 (+ strand) : 208 bp

chr11:17049963..17050097 (+ strand) : 135 bp

chr11:17050180..17050371 (+ strand) : 192 bp

chr11:17050454..17050626 (+ strand) : 173 bp

chr11:17050721..17050909 (+ strand) : 189 bp

chr11:17050994..17051110 (+ strand) : 117 bp

chr11:17051189..17051273 (+ strand) : 85 bp

chr11:17051355..17051507 (+ strand) : 153 bp

chr11:17051590..17051715 (+ strand) : 126 bp

chr11:17051846..17052028 (+ strand) : 183 bp

chr11:17052278..17052439 (+ strand) : 162 bp

chr11:17052553..17052669 (+ strand) : 117 bp

3'UTR

chr11:17052670..17052914 (+ strand) : 245 bp

FASTA

>Os11t0484300-01 class=Sequence position=chr11:17046950..17052914 (+ strand)
AGCAGCCACT CCTCCCCACC TTACTCCCCC CCGCTTCCAC TCCCCCGAAC CTTCCAGAAC CTTCTCCCGC TCCCCCGCCG
AGATGGTAAG CTCCCCTTCC TCTTCCTTCA GCGCGGCGGC GGCGGCCGGA TCTGACGCCT CGCCGTGTTT TTTTTTCTTT
TTTGGGTAGG ATGACTCGGA GAACAACGCG CCGTCGACGC CGGGGTCGCC GGGGTTCAGC ACAGACAGGC TGCCGCCGAA
CACCACCACC AGCCGCGGCG CCACCGACCC GTCCTCCTAC TCGGACGACG ACGACGACGA CGTGGTTGGC GCGGAGGAGG
CGGAGGTCGA CCCCAACGTG CTCCCCGAGG ACGACGGCGT CGTCGCCGCC GAGGAGGAGG AGGACGGGGA GGACCTCTTC
AACGACAACT ACCTCGAGTA AGCGAGAATT CCCAGATCTG ATGTTCATTC TAGTTCGGTT GACAAGTGAG ATCTGGTTTG
ATTAGAAGTT TGTTTTTGTG GCTTAGTGGG AGAATTAGAA GTTTTAGTGT TTATGTTAAA TATTTGCTTT AGGGATTGGC
AAATTTGGCC GTTGACTGGC TCATATAAGA GGGATTGACC AATTACTTGA CTAAATTGTG TACTTTTTGG TCAAAGAATT
TTAAGTACGA TTTTTTACTG TAGTGGTGCT ACAGATACTT CGATGGTGTA GAAGCAAACA ACTCTTAGCC TACTGTGTTC
TGTCACAGTG AAATGTCCAC GAAGTTCTTT CATTTTGATT AGATAATCTC TTGCTCTGTT TAATTACCTA TAGGTTTGTT
AATTTTGGTT TACATGTGTA AATTAGTTGA GGGATTTGTT GATCACTTCG CCTGTTGCCT TGATGCTTAT TCTGTTAAGT
TATGTAGTTG GCACAATAAA CGGATACAAT ACATTTGGCT GTTAATTTGC CTAATTGATA TTGTTTGAAT TAACGGTCCT
CTTGCTACAC AGTTTCTTTT AGCAGTTCAG TACAAAGGGA CTACCTGTCT TTATAAATCC ATGAAACATT ATAAAACTCT
CAAGTCAATG CAAACTCGTC AGATGTTGCA AGTTATTGTT AAATTCCACA GTTTTGATTA ACATATTGCA TCTTTTCCCT
CCTTTTATAG TGATTACCGG AGGATGGATG AGCAGGACCA GTATGAATCG GTTGGGTTAG ATGACTCGAT AGAGGATGAA
AGGAACCTGG ATGAGATCAT GGCAGATAGA AGGGCTGCTG AAGCAGAACT TGATGCAAGG GATGTGAGGA CTGGTGCAGC
ACCTGATAGG AAATTGCCAC GGATGCTACA TGATCAAGGT AATGGCATTG TGAAAAATTG CATTTCCATG AGATATTAGA
ACTGAACCCC ACCTTTCTGC TGTTGTACTT TATATTCTTG TTACTTGAGA ATTTGAGATA TGTTAATTTG ATATGGTTAG
CTTTAGTCGA ATGCTATGTT TTAATGCTTC TTGGGTCAAC TATATGTAAC TGAGGTTGTA TACTCCATTT GCATTTGCTT
CTTTTAAGTC TGATTCAACC CGTAGTGTGG TTGTGAATTT TGAGTTTTGG ACTTCAGTGA TGATTTTTTC TTAAATATTC
AATATGGAGC ATCACATTAC TGAATATATT ATCTGAGTTT GACATTGTGG TATGGTTGTG AACTTGCAGT AGTAATCCTT
TCTATATTTA CTAAAATTAG TTTGCTTGAA ACTTGTTTAT TCTTTCTATG AGATATTCTT TCTGGTCAGT TGGTCTTGGT
AATTGTAAGT TGAAGATAGT GTTTCTTTTA TGGTGCAGAC ACAGATGAGG ATATGAGCTT CAGGCGTCCT AAAAGGCACA
GAGCTAATTT TAGACCACCA AGGGAACCAA GAACACCAAG AAGTGATGAT GACGGTGATG GTGCCACGCC TAGTTCACCT
GGAAGATCTC AGCGTGGAAT GTATTCTGGA GGGGATGTAC CTATGACTGA CCAGACTGAT GATGATCCAT ATGAGGTATT
GATGTTTGAA CTAAAATTAC CTTAAGTTCC TTTAGATTTT CCAATTGGTC GCCGTCCTAT TTGCTGAGCA TATTTTATAT
GCAGGATGAA TTTGATGAAG AAGATGAGAT GAACATGTAC CGTGTACAAG GAACTCTTAG AGAGTGGGTC ACAAGAGATG
AAGTCCGCCG CTTTATCGCA AAGAAGTTCA AAGAATTCCT TCTAACATAT GTAAACCCAA AGAATGAACA AGGAGAGTTT
GAGTATGTTC GACTAATCAA TGAGATGGTT CTAGGTATGA TTCTCTTTTC CTTTTTGCAT GAAAAAAGGC CACATTTGTT
GGCATTGTAA GAAATGCTTG CTTACCTAAT GTTTCCTCTC CTCTTTGCAG CTAACAAATG CAGCTTAGAG ATAGATTACA
AGCAATTTAT TTATATACAT CCAAACATTG CTATATGGTT GGCTGATGCA CCTCAATCGG TGCTAGAAGT TATGGAGGAA
GTTGCCAAAA ATGTTGTTTT TGATCTCCAT AAGAACTATA GGAACATTCA TCAAAAAATC TATGTCCGAA TAACCAATCT
TCCTGTCTAC GACCAAATAC GCAATATCAG GTCAGTACAT GCTTTCTTTA GTATGGTATT TAGAAGTCAA ATTGATTGAT
TGTCTGTGCT TATATGCTAC TTGCCAAATT TCAGGCAAAT CCATCTGAAC ACAATGATTC GAATTGGTGG TGTTGTTACT
CGGAGATCAG GTGTTTTTCC TCAGCTACAA CAGGTCAAGT TTGACTGCAG CAAATGTGGG ACTGTCCTGG GCCCCTTCTT
CCAGAACTCT TACACTGAAG TCAAGGTTGG ATCCTGCCCT GAGTGCCAAT CCAAAGGGCC ATTCACCATC AATGTTGAGC
AAGTAAGTTG CCTGGGACGA TGGTAGTTCT GATACATTTG GGCTTTCTTC TCTGTCTTAA TGCATGAACA TGTTTTTGGT
TCTAATATTC AAACTGTTCT CTTTTAATAA CAGTTGATTT ATTTGTCTCA CAGACCATAT ATAGGAACTA CCAGAAACTC
ACTCTTCAGG AAAGCCCAGG AATTGTTCCT GCTGGCAGGC TTCCAAGATA CAAGGAAGTG ATACTTCTGA ATGATTTGAT
TGACTGTGCT CGACCAGGAG AGGAAATTGT AAGTCTTCTG CATGTACCTT TTTTATTTCT ACATCTTATT GTAGAAAGCA
TGTTCTAATT GACTATCTGC CCATGTTCAG GAGGTCACTG GGATATACAC CAACAATTTT GACTTGTCTT TGAATACAAA
GAATGGTTTC CCAGTTTTTG CCACAGTAGT GGAGGCAAAC TATGTGGCAA AAAAACAGGA TCTGTTCTCT GCTTACAAAT
TAACTGATGA GGACAAGGCG GAGATTGAGA AGTTGGCAAA AGATCCACGG ATCGGTGAAA GGGTTTGTGC TTAATCCTTA
AGCCCCTTGA CTCAATTATA ATAAGCTAAT CAGTATTGTC TGACAAATGA CTTATTGTTT ACAGATTGTC AAATCAATTG
CACCATCCAT ATATGGTCAT GAAGATATCA AGACTGCCAT TGCACTAGCT ATGTTTGGGG GGCAAGAGAA GAATGTCAAG
GGAAAGCATC GCTTGAGAGG AGATATCAAT GTACTCCTCT TAGGTGATCC AGGCACTGCA AAATCCCAAT TTCTCAAGTA
AGGAATAGGC AATCAGTTTC ATCATCTCTC TTTTTATTGC TCCATTAACT CAATATTTCA TTATCTAAAA AATTAACTCA
CTGTTTTGTA GGTATGTTGA GAAAACTGGA CACAGAGCAG TGTACACAAC TGGAAAAGGA GCTTCTGCTG TTGGACTCAC
CGCAGCAGTT CACAAGGATC CAGTAACACG GGAATGGACA CTTGAGGGTG GTGCACTAGT GCTTGCTGAT AGAGGCATAT
GCCTTATTGA TGAATTTGAT AAGATGAACG ATCAAGATAG GTATGTGTAA TACCATTTGG ATAATGTGTG CTTTTAAGCA
TTTATGTTCT ATTGCCCTAA GATATCTTTC TCTTATTGTT TCAGGGTGAG TATTCATGAG GCCATGGAGC AACAAAGTAT
CAGTATATCA AAGGCCGGAA TTGTCACATC CCTTCAAGCT CGGTGCAGTG TTATTGCTGC AGCAAACCCA ATAGGAGGAA
GGTGATGTGA TCTACTTGCT CAGGATGTTT TCAAACAATT GTTTTGAGCA ATATACTTAA TTTTATCATG TTATTGCAGA
TATGATTCAT CGAAGACATT CACCCAGAAT GTTGAACTGA CGGATCCAAT TATTTCACGT TTTGATGTCC TTTGTGTTGT
GAAGGTTTGG AGCTGATTTT GCTGTGTAAT ATATTTTTGC AGTCCTGGTA TCTATCTGTA CTGATTTTTT CTGGTGCAAA
TGCAGGACAT TGTTGACCCA TTTACAGATG AAATGCTTGC AAGGTTTGTT GTAGATAGTC ATGCAAGATC TCAACCCAAG
GGTGCTAACC TTGAAGATAG GGTTCCAACT GATGTTGAGG ATGATCCATT GGCTGCTGCC AGACAAGCTG ACCCAGATGT
ACGAACCCTT TGTACTTCGC ACAACAGAAA CATTTTTTTA CTAAATTTCA TTGTTTTTAA CAAAATCCTA TATTTTTTAG
ATCCTTTCTC AAGACATGCT GAAGAAGTAC ATAACTTATG CCAAGTTGAA CGTGTTTCCC AAAATTCATG ATGCTGACCT
GGACAAGATT AGCCATGTTT ACGCAGAACT TCGTCGTGAG TCATCTGTAA GATATCCTTG TTTCTTGTCC ATATCAAATG
CATCTTATCA AATACTTAAA TATCTTGCCG AATTGGATAT TGATACCTAT GAAAACTGGA AACCAACATG ATATCCAACC
TATTTTCTTG TTTCAGCATG GTCAAGGAGT CCCTATTGCC GTAAGGCATA TCGAATCCAT TATTCGGATG TCAGAGGCAC
ATGCAAGGAT GCATTTGAGG AGCTACGTGT CTCAGGAAGA TGTCGACATG GCTATCCGCG TCCTGCTTGA CTCATTTATT
TCAACTCAGA AGTTTGGTGT ACAGAAAGCA CTTCAAAAGG TAAATTTTGA TTTTGCTGTT GTATTGCTAT TCTATCATCT
TCCAACTGAT GCATACCTAG CATGAGTTTG AACTGTTGTA AGCTGCCTTA GTTTTTTAGC AAATGTTACT TGCATTATGC
GGTCTATTAC TTGCTGAACT CATTCCGAGC TCAAACCTAT GCCCCTTCCT TTCTTTGTTT TCACCAATGT AACTGTAGTT
CCTCACCATT TCTGCAAATT TTAAAGTATG TTTCTTCTGC CTCTACAGAA TTTCAGGAAA TACATGACCT ATAAGAAGGA
TTACAATGAG CTGCTCTTGC TTCTTCTGCG CACCCTGGTC AAGGATGTGC TGCACTTCGA AGAAATCGTT TCAGGACCAA
CGACGCGCCT GACTCACATC GAGGTTAAAG TAGAGGACCT GAAGAACAAG GTATGAGCCA AGATCTCCGC CTCACCCACA
CGCCTTTCTA ACCAAGCTTA TTGCGCAAAA ATGCTTCGTC ATCCAGATTT CGCTCTTGAT TCCGGTACAT CTGTCTGATG
CAGGCCCAGG AGTACGAAAT CTATGACCTG AGACCGTTCT TCTCCAGCGC CCACTTCAGG GACAACAACT TCGTCCTCGA
CGAAGGGCGG GGGATCATCA GGCACCCTCT TGCTGCCTAA CTACAGAAGA TCATCTGTGA CCCATCTGAC AATGAACAAT
TTGAGCTACC TCATGGGATT ATCAGACATA GTGTAATCAT CAAATGGCAA CTCCTTTGTG CTTTTTAGAG ACTGTTGCAT
GTTATCCAGC TGCATTTGGA TAGGGTGTAC CGTGTGTACT TTCTTAACAT TGTAATTCTG CAAGTATGGT AGAAAATGAT
AAATCTGTGT CAATCAATGT ATCATTGTTT TGCATTATTG TTTTC

Locus: Os11g0484300

Loading...

Locus: Os11g0484300

Loading...