Os11t0490600-02

Locus

Os11g0490600

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

LAZY1

CGSNL Gene Name

LAZY 1

Oryzabase Gene Symbol Synonym(s)

lazy1, LA1, OsLazy1

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK104957 (DDBJ, Best hit)

Protein Evidence

A2ZED5 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-114-B05 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0490600-02)

RiceXPro (AK104957)

Others

Oryzabase (7270)

KEGG (Os11t0490600-02)

Transcript

1489 bp

>Os11t0490600-02 Hypothetical conserved gene.
GTGTTCAAAGAGTTCAACACCGGAGGAGGTGGGGCCTGCAACTGCATCACCGGGCTTGCC
TCGCCTGACCACGACAACGACTACTTCTCCGGCGACGACGCCGCCCACGCCTCGCCGCCG
GTCACCGCCGGCGACCTCTTCACCTTCGGCGGCAGCGGCCTTCTCACCATCGGCACGCTA
GGCATCGCCGCCGTCGCCATTCCCAGCGGCGGCGACGACGACGACTACGACATCGACTTC
GAGGTGGACGCCACCAGCGACGACGACGGCGGCTTCACCGTCGAGGACGACGACGCCGAC
GTCGGCGGCGCCGTCACGCCCACCTTCACCTTCCCCGCGGCGACGGCGGCGGAGGCGGTC
GTCGCCACCGTGGAGAAGGCAGTGGCCGCGGTGGAGGCGATCGCGGAGAAGGACGACGAC
ACCACCACGGAGGACGACCTGATGGTGGTGAGCGCCGAGCTGGAGAAGGTGCTCGGCGGC
GTCGACGTGGCGTCGGCGCGGGTGAGCTTCGCCATGGGCGGTGGCGTCGACTGCCCGCTC
CAGGGCTTCCTGTTCGGCTCCCCGGTGAGCGACGTCGAGTCGCGCCCGGAGTACCTGCAG
GCGCCGCGGGACTCGTCCGGCTCCTGCGGCGGCGGCGGGCGGCGCACCTCGCTCGGCGAG
CTGTTCATGCGCACCCGCTTCGCCGACGAGAAGGTGGCGCTCGTCGCCGTCGCCGAGGGC
GAGGACGGCGTCGCCGGCGACGACGGCGCTGCTGCTGCCGGCGTCGGCGGAGACAGAGCG
GGGAAAGGCGGCGGCTACAAGACGATGAAGAAGAGGAAGGTGAAGGACGAGAAAGGCGGC
GGCGGCGCCGCCGGCGGTGGAATGCCGGCGACGGTGACGAAGAGCAAGTTTCAGAAGATC
CTTCAAATCTTCCACAGGAAAGTCTACCCCGAGAACACACTCCTCACAAGGAATCTGACC
AAGAAGAGCCGCAACCGCGGCGCCACCGATAATGGCGGTGGCGCCGTGGCCACCGGAGAC
CCCGACGGGCCTCTGGCCTCGCCGGTGCTCCGGTGCCGGAAGGACCATCCCATGAGGGGC
TTCGGCTGCTGCACCAATGGCGCCTTCGGTGCATCGTCACCGGGAGGCAACGCCGAGATG
AACGGCAACAAGAGCGGCCACTGGATCAAGACTGATGCCGACTACTTGGTGCTGGAATTA
TAATGGGGAAAAGAAGAGGAGCTATTTGTTTCATCAAGAATTAAAGCTTGAATAGTGAGC
ATCTCATATATATGAATATGTGCTTGCTGTTACAATATAATCTCTATCTGTTTGGTATAG
AAGGGCTTGAATGTGCTGTATATGTCACTATATATTGGGGGGGAGAGGATTACTATGAGA
TCAACTCATAAGTGTGTGGTGTTTATATACATTGCTCTGTGAATGTATGACAGAGATCAG
AACTTAATGTATTGTATGCTTTCTTGATGTGATTGGTGTTTATGAGCCT

CDS

1203 bp

>Os11t0490600-02 Hypothetical conserved gene.
GTGTTCAAAGAGTTCAACACCGGAGGAGGTGGGGCCTGCAACTGCATCACCGGGCTTGCC
TCGCCTGACCACGACAACGACTACTTCTCCGGCGACGACGCCGCCCACGCCTCGCCGCCG
GTCACCGCCGGCGACCTCTTCACCTTCGGCGGCAGCGGCCTTCTCACCATCGGCACGCTA
GGCATCGCCGCCGTCGCCATTCCCAGCGGCGGCGACGACGACGACTACGACATCGACTTC
GAGGTGGACGCCACCAGCGACGACGACGGCGGCTTCACCGTCGAGGACGACGACGCCGAC
GTCGGCGGCGCCGTCACGCCCACCTTCACCTTCCCCGCGGCGACGGCGGCGGAGGCGGTC
GTCGCCACCGTGGAGAAGGCAGTGGCCGCGGTGGAGGCGATCGCGGAGAAGGACGACGAC
ACCACCACGGAGGACGACCTGATGGTGGTGAGCGCCGAGCTGGAGAAGGTGCTCGGCGGC
GTCGACGTGGCGTCGGCGCGGGTGAGCTTCGCCATGGGCGGTGGCGTCGACTGCCCGCTC
CAGGGCTTCCTGTTCGGCTCCCCGGTGAGCGACGTCGAGTCGCGCCCGGAGTACCTGCAG
GCGCCGCGGGACTCGTCCGGCTCCTGCGGCGGCGGCGGGCGGCGCACCTCGCTCGGCGAG
CTGTTCATGCGCACCCGCTTCGCCGACGAGAAGGTGGCGCTCGTCGCCGTCGCCGAGGGC
GAGGACGGCGTCGCCGGCGACGACGGCGCTGCTGCTGCCGGCGTCGGCGGAGACAGAGCG
GGGAAAGGCGGCGGCTACAAGACGATGAAGAAGAGGAAGGTGAAGGACGAGAAAGGCGGC
GGCGGCGCCGCCGGCGGTGGAATGCCGGCGACGGTGACGAAGAGCAAGTTTCAGAAGATC
CTTCAAATCTTCCACAGGAAAGTCTACCCCGAGAACACACTCCTCACAAGGAATCTGACC
AAGAAGAGCCGCAACCGCGGCGCCACCGATAATGGCGGTGGCGCCGTGGCCACCGGAGAC
CCCGACGGGCCTCTGGCCTCGCCGGTGCTCCGGTGCCGGAAGGACCATCCCATGAGGGGC
TTCGGCTGCTGCACCAATGGCGCCTTCGGTGCATCGTCACCGGGAGGCAACGCCGAGATG
AACGGCAACAAGAGCGGCCACTGGATCAAGACTGATGCCGACTACTTGGTGCTGGAATTA
TAA

Protein

401 aa

>Os11t0490600-02 Hypothetical conserved gene.
VFKEFNTGGGGACNCITGLASPDHDNDYFSGDDAAHASPPVTAGDLFTFGGSGLLTIGTL
GIAAVAIPSGGDDDDYDIDFEVDATSDDDGGFTVEDDDADVGGAVTPTFTFPAATAAEAV
VATVEKAVAAVEAIAEKDDDTTTEDDLMVVSAELEKVLGGVDVASARVSFAMGGGVDCPL
QGFLFGSPVSDVESRPEYLQAPRDSSGSCGGGGRRTSLGELFMRTRFADEKVALVAVAEG
EDGVAGDDGAAAAGVGGDRAGKGGGYKTMKKRKVKDEKGGGGAAGGGMPATVTKSKFQKI
LQIFHRKVYPENTLLTRNLTKKSRNRGATDNGGGAVATGDPDGPLASPVLRCRKDHPMRG
FGCCTNGAFGASSPGGNAEMNGNKSGHWIKTDADYLVLEL*

CDS

chr11:17319360..17319387 (+ strand) : 28 bp

chr11:17321354..17322222 (+ strand) : 869 bp

chr11:17323600..17323885 (+ strand) : 286 bp

chr11:17324102..17324121 (+ strand) : 20 bp

3'UTR

chr11:17324122..17324407 (+ strand) : 286 bp

FASTA

>Os11t0490600-02 class=Sequence position=chr11:17319360..17324407 (+ strand)
GTGTTCAAAG AGTTCAACAC CGGAGGAGGT ATGCACGCAC AACTTAATTA ATCTATTTTT TGTCCTTTTT TTCTTATGTT
TAATTGATGA AGTATAATTG TTTTGAAAAA TACAGTAGCT CGTAACACAA ACGCACTCAC CTCTAGTACT CTCTCCAGTG
TTTTTATATA TTAAACTAAC GTCATATAAA AAATTGAAGT TAGTATATAT GTATAATAGT TCATCGGTAC ATGCAGAAAA
AAAAAAGAGT TTGTCTCTGG TTTTAGATCT GTAAGCATGC CCACAATAAT GAGAAAACCA CTGCAAAATT GTTGGCCGGC
CGGTCCCACA TGTCATTGAC CAGATTAGCC GTCTGAAGTG CTGAACTGTA TGGAACACTA GCAATCATCA ATGGGAGTTT
TGCACTCTTG CGCTTGGTCA CATTGGAGAT GGCACATCTA TCTATAATAT CACACATGCC ACTTTTCTTC CAGCCTCAAT
ATCTATAGTT CCAGCACTAG CTAGCTAGCT AGACCAACTA TTGCATAGCA AGAACCCTAT ATTATCATTT TGCAGATAAC
ATTTTCTTTT CCATGTAGTA ACATTGCCAT GGAAAGATCA CGAGGGCATG TCTATCTTTT GTGAAACTCT CTCTCTCTCC
TTTTGAAGGC TTCCTTTGAG AGTTTTCTCC TTGTTGGACT GTTGCTCTTA GGCTCAGCAT GTTAATATCA GAGTTTTCGC
CCGTTTTTCA TAAATCAATT GTGCCGTTGT AAGATTTTTG CGTCCAGTTT TCCTTATAAA CTGGACCTCT CTGCCTGTTT
CCTCGAGAAA AATTGTCCAA GAGCATTCTC GACGATTCAA CAACTAGAAT TCAACAAATA AAGATTTTTA TATATGGTGC
ATATGGTACG GTGAGATATT GTATTTTTAG TGTGAGATAC CAAAAGAGCT ACAACAAATT AATACGATAA AATAAGGGAA
ATTTCATGGA CTAACTAGTT AGAAACATAT TTTGAGTAAA TGAAAATTTT ATTTTATTAC CTTGGTTTAC AAAAgactta
taataagtgc tgtcaaacat ctaaaatgtt aaattcttaa tagacgaaaa gtattagaat ttaaaacgtg aaaattatat
actttttgat gaaaaatagt aggaatgtga aaattatatt agtagacttt ttttgatgaa aactctttca tatagttata
tgttaatttt ttataactat atagtttgag aaagtaatca tataactttt gcattaaaaa atgtgtcaat gtccaaaacA
TTATCTTAAT TAACCCGGTC CTTCTCCTCC CAAAGGAACA CATAAAAAAG GACAAAAACC AATACATCTT GAAAAACTTA
CATAGAAAAA GCTTAATCAT ATTTTATATC ACCCTGATCC CGTTGCAACG CACATGAATG TAACTATTTC TTTTTAAAAT
GGTGTTGTAC TTCATAAATT TGAAACAAAA AAAATACATA TAATGTAACC CTTTTAATTT CTGAAACACA TCAAAACTTT
TCTTTCTCAA AAAAAAGAAA AGAAAACACA TGAAAGCCTG CATAATTTTG CATGCAAATG ATCGtactcc ttccttttta
aggttacaag actttcttac attacccaaa tttatataga taataaatct agacacaaat atatgtgatt tattaatatg
tatatgaatg tgaacaatgc caaaaagtct tataatataa aatggagaaa gtaTTTaata ctccctcagt ttctaaatat
ttgacaccat tgatttttta aacatgttta atcattcgtc ttattcaaaa attttaagta attattaatt attttcctat
catttgattc attgttaaat atacttttat gtatacatat aattttacgt atttcacaaa agtttttgat aagacggacg
gtcaaacatg tgctaaaaag tcaactgtgt cagatattta gaaacggagg gagtaATTCA CTGTGTGACT GCAGGTGGGG
CCTGCAACTG CATCACCGGG CTTGCCTCGC CTGACCACGA CAACGACTAC TTCTCCGGCG ACGACGCCGC CCACGCCTCG
CCGCCGGTCA CCGCCGGCGA CCTCTTCACC TTCGGCGGCA GCGGCCTTCT CACCATCGGC ACGCTAGGCA TCGCCGCCGT
CGCCATTCCC AGCGGCGGCG ACGACGACGA CTACGACATC GACTTCGAGG TGGACGCCAC CAGCGACGAC GACGGCGGCT
TCACCGTCGA GGACGACGAC GCCGACGTCG GCGGCGCCGT CACGCCCACC TTCACCTTCC CCGCGGCGAC GGCGGCGGAG
GCGGTCGTCG CCACCGTGGA GAAGGCAGTG GCCGCGGTGG AGGCGATCGC GGAGAAGGAC GACGACACCA CCACGGAGGA
CGACCTGATG GTGGTGAGCG CCGAGCTGGA GAAGGTGCTC GGCGGCGTCG ACGTGGCGTC GGCGCGGGTG AGCTTCGCCA
TGGGCGGTGG CGTCGACTGC CCGCTCCAGG GCTTCCTGTT CGGCTCCCCG GTGAGCGACG TCGAGTCGCG CCCGGAGTAC
CTGCAGGCGC CGCGGGACTC GTCCGGCTCC TGCGGCGGCG GCGGGCGGCG CACCTCGCTC GGCGAGCTGT TCATGCGCAC
CCGCTTCGCC GACGAGAAGG TGGCGCTCGT CGCCGTCGCC GAGGGCGAGG ACGGCGTCGC CGGCGACGAC GGCGCTGCTG
CTGCCGGCGT CGGCGGAGAC AGAGCGGGGA AAGGCGGCGG CTACAAGACG ATGAAGAAGA GGAAGGTGAA GGACGAGAAA
GGCGGCGGCG GCGCCGCCGG CGGTGGAATG CCGGCGACGG TGACGAAGAG CAAGTTTCAG AAGGTAACTT TTTTTTTTGT
TGTTGCTAGC ATTTTAATTT GCTTTGAAGA AAACTATAAA ATATCTGCAA TTTTGGCTGA CTATTTCATG AGGTTTCCTT
GGATATGATC ATTTGATTAA TTAGTTCGTT CGATTGCTAT AGTTTTAGTT CATTTTTCTT TAATTAATTT GTAATAAAAC
TCAAGAGTTA TTGTGAGTTT TTTTTTTATT ATTTTTGCTT CAGTACGTGC ATTTTCTACT AGTGAAACTT CAATATTAAC
CAGGCCAGTC GACATTTCTT AATTGTGATT TGATTTAAGG GTCAAGATTA GAACTATAGA TTGAATATGC AAAGTTTCAG
CTCGGACGAC ATTTGAACAT TTGACTAATT ATATATTTCC GAGTTCAATT GTTTGCCGGT AAAATTCTGA ACTTGCAGTT
GGAACATTCA AGATTCAACT CTGATTCACA TGATCTCGAA CTCAATATCT CCAACTTTAT AAAAAGACAA AAAGATTACT
GCTCAACGGT GAGTTTAATG AAGGAATGCT CATCACAGCA AATCCATAAT TCTATATAAC TCTCTGTAAT ATGTAATGGT
AAGAAACAGA TATTCATGAT TAAATCATTT TTCCCCTTCA GAAAGAAATA CTGATTTTTC GTGGTACATC CAAAATTACT
CCAAAGTTTA CACTGAATTT CACGCTGTTC TTGGTGTTTA AGATTAATTT TAGGTAGATA TTTTCTAGTC CCGCAACAAA
GCTGACAATG AAAACCCCAA AACTAATCCT AAATGAAATT CTAAAATTAA GAAAAACAGC TTTAGATTAT AAATTTTAAT
AGTAAGTCCA AGGAAATAGC CAGCAATGTT AATAAGATTG CTGATAAGAA TATATAACAG TTTGGAGCCA ATCCATTTCA
CATGTGTATC CTGCTCTGGG ACATAAGTAG ACACAAATCC CGAGTTTTGA CTATCATCTC ATAATCGGAA GATCTTTCAC
TGTGTCGTCA GATTCGAGTT AAGTTTCTGT AGACCAACTT GGTGTGTCAA TGGTGTTGTT AGGAGTGGGG ATACTGGGGG
CAGTGAGTTG ACATGCGATT TGTTTGCAAT CTCCTGTCTA ATGCTATCTT TATGGATCAT TTCATTTGTC ATTTTTCGTT
TGCCCCATAA ACAACAAGGG ATTCTTGATT TGATATATTA TACATCCTTC TAGGTGCTCT CTTGCATTTC TTTTCCTTGG
AGAGATGCTC CAAATATCCC TCAAAAGAAA TTCTAGATTC CTTTTGCTAC TACTTGGTAC TTACATTTAA TTTTGTTACA
ACGAATGAAA GAAACTGAGT TTCAGAAAGT GATCAAAAGT TGACAATGTT CTGAAATGAG GAAACATCTG CTCATTGCAG
ATCCTTCAAA TCTTCCACAG GAAAGTCTAC CCCGAGAACA CACTCCTCAC AAGGAATCTG ACCAAGAAGA GCCGCAACCG
CGGCGCCACC GATAATGGCG GTGGCGCCGT GGCCACCGGA GACCCCGACG GGCCTCTGGC CTCGCCGGTG CTCCGGTGCC
GGAAGGACCA TCCCATGAGG GGCTTCGGCT GCTGCACCAA TGGCGCCTTC GGTGCATCGT CACCGGGAGG CAACGCCGAG
ATGAACGGCA ACAAGAGCGG CCACTGGATC AAGACTGATG CCGACTGTGA GTAGCACTGC ACACCTTGGT GTCTCCATCC
ATCTTCAATG GATCTATCTT TGCAATCATG CATTCAGTCT TGACAGCTAC ATCTTTCCAT ACTATTTTTG GGGAATCTTC
CAAGAGCTAT CCATCACTAG TTTCTGAGTT ACTGTGTGCT GATGCACACA CTGCAAACAT TGTGCTTTTT CACTGAAACC
CTGTCTCTCT GATCTGATGC AGACTTGGTG CTGGAATTAT AATGGGGAAA AGAAGAGGAG CTATTTGTTT CATCAAGAAT
TAAAGCTTGA ATAGTGAGCA TCTCATATAT ATGAATATGT GCTTGCTGTT ACAATATAAT CTCTATCTGT TTGGTATAGA
AGGGCTTGAA TGTGCTGTAT ATGTCACTAT ATATTGGGGG GGAGAGGATT ACTATGAGAT CAACTCATAA GTGTGTGGTG
TTTATATACA TTGCTCTGTG AATGTATGAC AGAGATCAGA ACTTAATGTA TTGTATGCTT TCTTGATGTG ATTGGTGTTT
ATGAGCCT

Locus: Os11g0490600

Loading...

Locus: Os11g0490600

Loading...