Os11t0506800-00

Locus

Os11g0506800

Description

Similar to BAG domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BAG5

CGSNL Gene Name

BCL-2-ASSOCIATED ATHANOGENE 5

Oryzabase Gene Symbol Synonym(s)

OsBAG5

Oryzabase Gene Name Synonym(s)

Bcl-2-associated athanogene 5

Transcript Evidence

FP100206 (DDBJ)

Protein Evidence

B6UF50 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: chaperone binding (GO:0051087)

Functional domain (InterPro)

IQ motif, EF-hand binding site (IPR000048)

BAG domain (IPR003103)

Expression Databases

TENOR (Os11t0506800-00)

Others

Oryzabase (11553)

Transcript

1437 bp

>Os11t0506800-00 Similar to BAG domain containing protein.
ATGGCGTCGTCGTCTCGTCGATTCTTCGGCTACGACCCCTACGACTACTACTACACCTCC
TCCCCCTACGACTACGCCTACCCGTACTACACCCCCGCCCCCGCCGCCACCGACCGCCGC
CGCCACGCCTCGCCGCGGTTCTTCCCGGCGGCGGCGGCCGATGAGGAGTACAGGTACGGC
GAGCCGGTGGAGACGGTGGACGTGCTGCGCCCGAGCTCCTCGAGGAGGAGCAGGGCGAGG
CCGGTGTCCGTGTCCGTCCCGGTGCAGTTTGCTGGGTCTGAGACGAAGGCGAAGGCGAAG
GGGTGTGAGAGTGAGATGAGTCCGCCGCGATCGGTGGCGAGGATTGGGAGggaggcggcg
gcggtgagggtgcaggcggcggcgagggggttcctggcgaggaggatggtgcgggaggtg
agggcggtggaggcggaggcggagggggtggcgaggaaggtggcggccgaggcggaggcg
ctgaggcgggacgcgagggggagggTCGCCCTCGGGGAGGCGCTCATGCGGCTGCTGCTC
CGGCTCGACGCGGTCCACGGCGCCAGGGAGTACCGGAGGAGGGTAACCAAGCGGGTCCTC
GCGCTGCAGGACGCCGTCGACGCCCTCGAGCACGTGCCGGCGGCGCCGCCCGTGGAGGAG
GAGGAGGAGGAGGCCCGCGTGGTCGCCGACGACGCCGCCCCGGCCCTCGACATGGAGGAG
GCTCACGACGCGCAGGAGGACATGATGACGCCGTCGCCTGCGCAGGACGCGTCCCAGCTC
GCGGACGACGCCCCGGCGGCCGTCGATGCCGTCGACATGGAAGAGAACGAGATGGCGCCG
GGGTCGCCGCGCGCCGAGGAGGAGCACGGCGTCGAGGCGGAACCGAAGCCCGAGGTGGAG
ATCCCGGTTCCTGAGGCGGGCACCGAGATGGaggtggacggggggcaagccaccggcggc
gaggccgagacggagaaagcggtcgaacaggtggtgggcggagagatgcaggaggcggag
gaagaggcggaaggcgagtgggagatggtgactgcagaatcccctttggaggccgccgcc
gccgacgacgacgtggaggcCGTGGAGAGCTCGGCGGCGCCCGCTGCGCGGGTCGACGAA
CCGGCGGTCCAAGATGAGGAGAAAGAGAAGGAGGAGGGGGTGGAGATGAAGAAGGTGATG
GAGATGGTGGCGGCGCTGTGCGAGCGGAGCGCGCAGCAGTGCGCGGTGATCGGCGCGCTG
GCGGAGCGGGTGGACGCGCTGGAGCGCGCCGTGCGGCGGGTGGAGGAGAGCGACCGGCGG
CGCCGCCGCAACAAGAAGCTCAAGAAGGAAGCCAAGGCGAACAGCTAGTCCATCCGAAGC
TGCTACAGCGATTGAATAAACAAGAGTTTTTTTTAGTTCTTAGCTTTTGGAGTTGGA

CDS

1368 bp

>Os11t0506800-00 Similar to BAG domain containing protein.
ATGGCGTCGTCGTCTCGTCGATTCTTCGGCTACGACCCCTACGACTACTACTACACCTCC
TCCCCCTACGACTACGCCTACCCGTACTACACCCCCGCCCCCGCCGCCACCGACCGCCGC
CGCCACGCCTCGCCGCGGTTCTTCCCGGCGGCGGCGGCCGATGAGGAGTACAGGTACGGC
GAGCCGGTGGAGACGGTGGACGTGCTGCGCCCGAGCTCCTCGAGGAGGAGCAGGGCGAGG
CCGGTGTCCGTGTCCGTCCCGGTGCAGTTTGCTGGGTCTGAGACGAAGGCGAAGGCGAAG
GGGTGTGAGAGTGAGATGAGTCCGCCGCGATCGGTGGCGAGGATTGGGAGggaggcggcg
gcggtgagggtgcaggcggcggcgagggggttcctggcgaggaggatggtgcgggaggtg
agggcggtggaggcggaggcggagggggtggcgaggaaggtggcggccgaggcggaggcg
ctgaggcgggacgcgagggggagggTCGCCCTCGGGGAGGCGCTCATGCGGCTGCTGCTC
CGGCTCGACGCGGTCCACGGCGCCAGGGAGTACCGGAGGAGGGTAACCAAGCGGGTCCTC
GCGCTGCAGGACGCCGTCGACGCCCTCGAGCACGTGCCGGCGGCGCCGCCCGTGGAGGAG
GAGGAGGAGGAGGCCCGCGTGGTCGCCGACGACGCCGCCCCGGCCCTCGACATGGAGGAG
GCTCACGACGCGCAGGAGGACATGATGACGCCGTCGCCTGCGCAGGACGCGTCCCAGCTC
GCGGACGACGCCCCGGCGGCCGTCGATGCCGTCGACATGGAAGAGAACGAGATGGCGCCG
GGGTCGCCGCGCGCCGAGGAGGAGCACGGCGTCGAGGCGGAACCGAAGCCCGAGGTGGAG
ATCCCGGTTCCTGAGGCGGGCACCGAGATGGaggtggacggggggcaagccaccggcggc
gaggccgagacggagaaagcggtcgaacaggtggtgggcggagagatgcaggaggcggag
gaagaggcggaaggcgagtgggagatggtgactgcagaatcccctttggaggccgccgcc
gccgacgacgacgtggaggcCGTGGAGAGCTCGGCGGCGCCCGCTGCGCGGGTCGACGAA
CCGGCGGTCCAAGATGAGGAGAAAGAGAAGGAGGAGGGGGTGGAGATGAAGAAGGTGATG
GAGATGGTGGCGGCGCTGTGCGAGCGGAGCGCGCAGCAGTGCGCGGTGATCGGCGCGCTG
GCGGAGCGGGTGGACGCGCTGGAGCGCGCCGTGCGGCGGGTGGAGGAGAGCGACCGGCGG
CGCCGCCGCAACAAGAAGCTCAAGAAGGAAGCCAAGGCGAACAGCTAG

Protein

456 aa

>Os11t0506800-00 Similar to BAG domain containing protein.
MASSSRRFFGYDPYDYYYTSSPYDYAYPYYTPAPAATDRRRHASPRFFPAAAADEEYRYG
EPVETVDVLRPSSSRRSRARPVSVSVPVQFAGSETKAKAKGCESEMSPPRSVARIGREAA
AVRVQAAARGFLARRMVREVRAVEAEAEGVARKVAAEAEALRRDARGRVALGEALMRLLL
RLDAVHGAREYRRRVTKRVLALQDAVDALEHVPAAPPVEEEEEEARVVADDAAPALDMEE
AHDAQEDMMTPSPAQDASQLADDAPAAVDAVDMEENEMAPGSPRAEEEHGVEAEPKPEVE
IPVPEAGTEMEVDGGQATGGEAETEKAVEQVVGGEMQEAEEEAEGEWEMVTAESPLEAAA
ADDDVEAVESSAAPAARVDEPAVQDEEKEKEEGVEMKKVMEMVAALCERSAQQCAVIGAL
AERVDALERAVRRVEESDRRRRRNKKLKKEAKANS*

CDS

chr11:18070382..18071749 (- strand) : 1368 bp

3'UTR

chr11:18070313..18070381 (- strand) : 69 bp

FASTA

>Os11t0506800-00 class=Sequence position=chr11:18070313..18071749 (- strand)
ATGGCGTCGT CGTCTCGTCG ATTCTTCGGC TACGACCCCT ACGACTACTA CTACACCTCC TCCCCCTACG ACTACGCCTA
CCCGTACTAC ACCCCCGCCC CCGCCGCCAC CGACCGCCGC CGCCACGCCT CGCCGCGGTT CTTCCCGGCG GCGGCGGCCG
ATGAGGAGTA CAGGTACGGC GAGCCGGTGG AGACGGTGGA CGTGCTGCGC CCGAGCTCCT CGAGGAGGAG CAGGGCGAGG
CCGGTGTCCG TGTCCGTCCC GGTGCAGTTT GCTGGGTCTG AGACGAAGGC GAAGGCGAAG GGGTGTGAGA GTGAGATGAG
TCCGCCGCGA TCGGTGGCGA GGATTGGGAG ggaggcggcg gcggtgaggg tgcaggcggc ggcgaggggg ttcctggcga
ggaggatggt gcgggaggtg agggcggtgg aggcggaggc ggagggggtg gcgaggaagg tggcggccga ggcggaggcg
ctgaggcggg acgcgagggg gagggTCGCC CTCGGGGAGG CGCTCATGCG GCTGCTGCTC CGGCTCGACG CGGTCCACGG
CGCCAGGGAG TACCGGAGGA GGGTAACCAA GCGGGTCCTC GCGCTGCAGG ACGCCGTCGA CGCCCTCGAG CACGTGCCGG
CGGCGCCGCC CGTGGAGGAG GAGGAGGAGG AGGCCCGCGT GGTCGCCGAC GACGCCGCCC CGGCCCTCGA CATGGAGGAG
GCTCACGACG CGCAGGAGGA CATGATGACG CCGTCGCCTG CGCAGGACGC GTCCCAGCTC GCGGACGACG CCCCGGCGGC
CGTCGATGCC GTCGACATGG AAGAGAACGA GATGGCGCCG GGGTCGCCGC GCGCCGAGGA GGAGCACGGC GTCGAGGCGG
AACCGAAGCC CGAGGTGGAG ATCCCGGTTC CTGAGGCGGG CACCGAGATG Gaggtggacg gggggcaagc caccggcggc
gaggccgaga cggagaaagc ggtcgaacag gtggtgggcg gagagatgca ggaggcggag gaagaggcgg aaggcgagtg
ggagatggtg actgcagaat cccctttgga ggccgccgcc gccgacgacg acgtggaggc CGTGGAGAGC TCGGCGGCGC
CCGCTGCGCG GGTCGACGAA CCGGCGGTCC AAGATGAGGA GAAAGAGAAG GAGGAGGGGG TGGAGATGAA GAAGGTGATG
GAGATGGTGG CGGCGCTGTG CGAGCGGAGC GCGCAGCAGT GCGCGGTGAT CGGCGCGCTG GCGGAGCGGG TGGACGCGCT
GGAGCGCGCC GTGCGGCGGG TGGAGGAGAG CGACCGGCGG CGCCGCCGCA ACAAGAAGCT CAAGAAGGAA GCCAAGGCGA
ACAGCTAGTC CATCCGAAGC TGCTACAGCG ATTGAATAAA CAAGAGTTTT TTTTAGTTCT TAGCTTTTGG AGTTGGA

Locus: Os11g0506800

Loading...

Locus: Os11g0506800

Loading...