Os11t0508600-01

Locus

Os11g0508600

Description

Sugar transporter, TAL effector-mediated susceptibility to bacterial pathogen

RAP-DB Gene Symbol Synonym(s)

11N3, OsSWEET14, Os11N3, Os-11N3, Xa41(t)

RAP-DB Gene Name Synonym(s)

11N3, Xanthomonas oryzae pv. oryzae resistance 41

CGSNL Gene Symbol

XA41

CGSNL Gene Name

XANTHOMONAS ORYZAE PV. ORYZAE RESISTANCE 41

Oryzabase Gene Symbol Synonym(s)

OsSWEET14, SWEET14, Os11N3, Os-11N3, 11N3, Xa41(t), xa41, Os11N3/SWEET14

Oryzabase Gene Name Synonym(s)

Xanthomonas oryzae pv. oryzae resistance 41

Transcript Evidence

AK101913

Protein Evidence

Q2R3P9

Literature

PMID: 21098734

PMID: 23879865

Note

Manual Curation

September 19, 2014

Gene Ontology (GO)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

SWEET sugar transporter, plants (IPR018179)

Full-length cDNA

J033071H09 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0508600-01)

Others

Oryzabase (9105)

KEGG (Os11t0508600-01)

Transcript

1492 bp

>Os11t0508600-01 Sugar transporter, TAL effector-mediated susceptibility to bacterial pathogen
ATCAAGCCTTCAAGCAAAGCAAACTCAAGTAGTAGCTGATTACCAGCTCTTCTCTCTTCT
CATTGAGAAGAGGGAATTAAGTTTTGATCTCTGCTTTATTGCCTGATCATCCTCTTGTTA
CTTGCAAGCAAGAACAGTAGTGTACTGTGCCTCATTGATCTCCTCCCACCAAACTCTCTC
TCTCTCTCTCATATTCCGAGCTAGCTAGTTAATCAAGATCTTGCTGCAATGGCTGGCATG
TCTCTTCAGCATCCCTGGGCCTTCGCCTTTGGTCTCCTAGGCAACATCATCTCCTTCATG
ACCTACCTGGCCCCACTGCCGACGTTCTACAGGATCTACAAGAGCAAGTCGACGCAGGGG
TTCCAGTCGGTACCCTACGTGGTGGCGCTGTTCAGCGCGATGCTGTGGATCTACTACGCG
CTGCTCAAGTCCGACGAGTGCCTCCTCATCACCATCAACTCCGCTGGCTGCGTCATCGAG
ACCATCTACATCGCCGTCTACCTCGTCTACGCCCCCAAGAAGGCCAAGATGTTCACCGCC
AAGCTCCTCCTCCTCGTCAACGTCGGCGTCTTCGGCCTCATCCTCCTCCTCACCCTCCTC
CTCTCCGCCGGCGACCGCCGCATCGTGGTTCTTGGTTGGGTCTGCGTTGGCTTCTCCGTC
AGCGTCTTCGTCGCCCCCCTTAGCATCATCAGGCTGGTGGTGCGCACCAAGAGCGTGGAG
TTCATGCCGTTCTCGCTCTCCTTCTCCCTCACCATCAGCGCCGTCGTCTGGTTCCTCTAC
GGCCTCCTCATCAAGGACAAATATGTCGCTCTTCCCAACGTGCTGGGCTTCTCCTTCGGC
GTCATCCAGATGGGGCTGTACGCCATGTACAGGAACTCGACGCCCAAGGCCGTGCTGACC
AAGGAGGTCGAGGCGGCGACGGCCACCGGCGACGACGACCACTCCGCCGCCGGCGTCAAG
GAGCACGTCGTCAACATCGCCAAGCTCTCTGCCGCCGTCGACGTCGTCAAGACCCGCGAG
GTGCACCCCGTCGACGTCGAGTCCCCGCCGGCAGAGGCGCCGCCTGAGGAGGACGACAAG
GCCGCCGCCGCCACCGCCGCCGCCGTCGCCGGCGCCGGCGAGAAGAAGGTAGCTGCATGA
GTGCGTGCATGCGTACATGGGTCGCCGTAAGAAGGAAGAAGGCGTGACGTGTCCAGCCCG
TACGCGCGCCACGTGGCCAAGCTAGCTTCAGAGCTAGTGAAGCTGCAGACATGCTAGCTG
GCTAGCTAGCAGTGAGAGAGTGCGACGACTAAAAAAAAAGTAGTGATTAATTAAGGGCTT
GTAATTTAATCGTTGTTTTTTTTTTCTCTGTTTCGTTGAGATCGATATCGTTGTCACCAT
GCATGTATTTCGTTTTTGATTCTCAGTAATTAATTAGATGGGCTTTCTGTAATTCAACCT
GTAAGGGTTCCTTCCATGATTAATTAATTAGCGTGTTAATAATTGTCCCACC

CDS

912 bp

>Os11t0508600-01 Sugar transporter, TAL effector-mediated susceptibility to bacterial pathogen
ATGGCTGGCATGTCTCTTCAGCATCCCTGGGCCTTCGCCTTTGGTCTCCTAGGCAACATC
ATCTCCTTCATGACCTACCTGGCCCCACTGCCGACGTTCTACAGGATCTACAAGAGCAAG
TCGACGCAGGGGTTCCAGTCGGTACCCTACGTGGTGGCGCTGTTCAGCGCGATGCTGTGG
ATCTACTACGCGCTGCTCAAGTCCGACGAGTGCCTCCTCATCACCATCAACTCCGCTGGC
TGCGTCATCGAGACCATCTACATCGCCGTCTACCTCGTCTACGCCCCCAAGAAGGCCAAG
ATGTTCACCGCCAAGCTCCTCCTCCTCGTCAACGTCGGCGTCTTCGGCCTCATCCTCCTC
CTCACCCTCCTCCTCTCCGCCGGCGACCGCCGCATCGTGGTTCTTGGTTGGGTCTGCGTT
GGCTTCTCCGTCAGCGTCTTCGTCGCCCCCCTTAGCATCATCAGGCTGGTGGTGCGCACC
AAGAGCGTGGAGTTCATGCCGTTCTCGCTCTCCTTCTCCCTCACCATCAGCGCCGTCGTC
TGGTTCCTCTACGGCCTCCTCATCAAGGACAAATATGTCGCTCTTCCCAACGTGCTGGGC
TTCTCCTTCGGCGTCATCCAGATGGGGCTGTACGCCATGTACAGGAACTCGACGCCCAAG
GCCGTGCTGACCAAGGAGGTCGAGGCGGCGACGGCCACCGGCGACGACGACCACTCCGCC
GCCGGCGTCAAGGAGCACGTCGTCAACATCGCCAAGCTCTCTGCCGCCGTCGACGTCGTC
AAGACCCGCGAGGTGCACCCCGTCGACGTCGAGTCCCCGCCGGCAGAGGCGCCGCCTGAG
GAGGACGACAAGGCCGCCGCCGCCACCGCCGCCGCCGTCGCCGGCGCCGGCGAGAAGAAG
GTAGCTGCATGA

Protein

303 aa

>Os11t0508600-01 Sugar transporter, TAL effector-mediated susceptibility to bacterial pathogen
MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLW
IYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILL
LTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVV
WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPKAVLTKEVEAATATGDDDHSA
AGVKEHVVNIAKLSAAVDVVKTREVHPVDVESPPAEAPPEEDDKAAAATAAAVAGAGEKK
VAA*

5'UTR

chr11:18174251..18174478 (- strand) : 228 bp

CDS

chr11:18174199..18174250 (- strand) : 52 bp

chr11:18173429..18173465 (- strand) : 37 bp

chr11:18172760..18173132 (- strand) : 373 bp

chr11:18172541..18172660 (- strand) : 120 bp

chr11:18172059..18172388 (- strand) : 330 bp

3'UTR

chr11:18171707..18172058 (- strand) : 352 bp

FASTA

>Os11t0508600-01 class=Sequence position=chr11:18171707..18174478 (- strand)
ATCAAGCCTT CAAGCAAAGC AAACTCAAGT AGTAGCTGAT TACCAGCTCT TCTCTCTTCT CATTGAGAAG AGGGAATTAA
GTTTTGATCT CTGCTTTATT GCCTGATCAT CCTCTTGTTA CTTGCAAGCA AGAACAGTAG TGTACTGTGC CTCATTGATC
TCCTCCCACC AAACTCTCTC TCTCTCTCTC ATATTCCGAG CTAGCTAGTT AATCAAGATC TTGCTGCAAT GGCTGGCATG
TCTCTTCAGC ATCCCTGGGC CTTCGCCTTT GGTCTCCTAG GTGTGTTGCC TTTGATCTGA TCCAAGGAAT TCTCTTGAGA
ATTAATCTTG CATGGTTATT TACTTTTGTT GTTATTATTC TCTACATTTT TAATCATGTA CTTTTCCATG TTCCACTTTT
GTTGCCAAAG CTACTATATT TTTCCTACCA ATTCATCCAA AACTACTATA TTATAGCAAG GCAGCTAGTG GATCGACTTT
GCACTTTTGG ATGCAATTGT GAGTGGTTTA CATTAGAGGG GCCATGCATA GCCAAATAAA TTGTTTGGCA AAATATGATT
TCCCTTGTAG TTAGCACAAT ATTGTGATCT TTCATTCCTT TACTCTTTTT GTTCCACCAC CCTCATTATT GCAAAGCCCC
CTCTTTTAGA ACCAAACTAA AGATAAGAAA CATTTGATTC ATCATTAGAG GAGATTAGAT ATACATACAT ACTACACATG
CATTGCTGTG ATAAGCCTAG CCAGGCACAG AAAGAGCCAA GACAAAAGGA GCTCAAAAGA AAAGGGGCTC CAATATCTTG
CCCGGCCTGA TCAGTGTAAC ATGACGTCAC CCACACAATT ATTAAAAGGA TAGATGCATA TGTGTTCGTT ACGTATCTCC
TTGTGTCACG TTGCTGTGCA TGGTTCACTC GCTTAATTAT AACGTCCGTC GCATTTTATG CATGCACTTC GTTTTTAGTT
AATCAAATTA AACAAGATCC TAACATATGA TTTCTATTTT ATTCTCTTTG CAGGCAACAT CATCTCCTTC ATGACCTACC
TGGCCCCACT GTAAGTCCCA CACATCCGGA TATTTTCTTT TCTTTAGCga aattttacat tgctccagaa agtacctttt
acactaaaat ttcttataca ccaccataaa attaatgtgg tactattggt accttatcaa aaatgataaa attaccTTTT
TCTTCAGATA AAAACACTCC CCGTCTCTGT ATAACTAAGA TGTAGACAAC CAATACACAT GTCTAGAGCT AATCCTATCA
ATTAACATTG CTAGTAAATA CAAGGAAAAA TATAAAGAAT TAACCAATTG CTTGGATGTC TTGCAGGCCG ACGTTCTACA
GGATCTACAA GAGCAAGTCG ACGCAGGGGT TCCAGTCGGT ACCCTACGTG GTGGCGCTGT TCAGCGCGAT GCTGTGGATC
TACTACGCGC TGCTCAAGTC CGACGAGTGC CTCCTCATCA CCATCAACTC CGCTGGCTGC GTCATCGAGA CCATCTACAT
CGCCGTCTAC CTCGTCTACG CCCCCAAGAA GGCCAAGATG TTCACCGCCA AGCTCCTCCT CCTCGTCAAC GTCGGCGTCT
TCGGCCTCAT CCTCCTCCTC ACCCTCCTCC TCTCCGCCGG CGACCGCCGC ATCGTGGTTC TTGGTTGGGT CTGCGTTGGC
TTCTCCGTCA GCGTCTTCGT CGCCCCCCTT AGCATCATCG TAAGAAACCC TAGAATTGCC TGTAAACAAT AATAACTTTC
GGTCTCTGCA CCAACTAAGG ATGCACATAT TTACGCACCG CTTTTGCTAT CTCTGCAGAG GCTGGTGGTG CGCACCAAGA
GCGTGGAGTT CATGCCGTTC TCGCTCTCCT TCTCCCTCAC CATCAGCGCC GTCGTCTGGT TCCTCTACGG CCTCCTCATC
AAGGACAAAT ATGTCGCTGT GAGTAGCTCC GATTCGACCC GTTCTTCTTC CTAAATTTTC CGCTGCTCGA TTTAATTTCT
ATTTCTAATT GTGGAAGATT GTTTAATTAT AGTGATTATG GCTAGCTGAT AACCGATTTT AATTTCTGAT GGTGATCCAA
AATGGAACAG CTTCCCAACG TGCTGGGCTT CTCCTTCGGC GTCATCCAGA TGGGGCTGTA CGCCATGTAC AGGAACTCGA
CGCCCAAGGC CGTGCTGACC AAGGAGGTCG AGGCGGCGAC GGCCACCGGC GACGACGACC ACTCCGCCGC CGGCGTCAAG
GAGCACGTCG TCAACATCGC CAAGCTCTCT GCCGCCGTCG ACGTCGTCAA GACCCGCGAG GTGCACCCCG TCGACGTCGA
GTCCCCGCCG GCAGAGGCGC CGCCTGAGGA GGACGACAAG GCCGCCGCCG CCACCGCCGC CGCCGTCGCC GGCGCCGGCG
AGAAGAAGGT AGCTGCATGA GTGCGTGCAT GCGTACATGG GTCGCCGTAA GAAGGAAGAA GGCGTGACGT GTCCAGCCCG
TACGCGCGCC ACGTGGCCAA GCTAGCTTCA GAGCTAGTGA AGCTGCAGAC ATGCTAGCTG GCTAGCTAGC AGTGAGAGAG
TGCGACGACT AAAAAAAAAG TAGTGATTAA TTAAGGGCTT GTAATTTAAT CGTTGTTTTT TTTTTCTCTG TTTCGTTGAG
ATCGATATCG TTGTCACCAT GCATGTATTT CGTTTTTGAT TCTCAGTAAT TAATTAGATG GGCTTTCTGT AATTCAACCT
GTAAGGGTTC CTTCCATGAT TAATTAATTA GCGTGTTAAT AATTGTCCCA CC

Locus: Os11g0508600

Loading...

Locus: Os11g0508600

Loading...