Os11t0512000-01

Locus

Os11g0512000

Description

NAC transcription factor, Promotion of grain filling, Seed development

RAP-DB Gene Symbol Synonym(s)

ONAC025, SS1, SS1/ ONAC025

RAP-DB Gene Name Synonym(s)

SUPER STARCHY1

CGSNL Gene Symbol

NAC25

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 25

Oryzabase Gene Symbol Synonym(s)

ONAC025, ONAC25, OsEnS-144

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 025, NAC domain-containing protein 25, endosperm-specific gene 144

Transcript Evidence

AK107369

Protein Evidence

Q2R3N5

Literature

PMID: 32995698

Note

Manual Curation

October 2, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain superfamily (IPR036093)

NAC domain (IPR003441)

Experimentally confirmed subcellular location

endoplasmic reticulum (GO:0005783) [mainly]

nucleus (GO:0005634)

Full-length cDNA

002-127-B02 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0512000-01)

RiceXPro (AK107369)

Others

Oryzabase (11471)

KEGG (Os11t0512000-01)

Transcript

1360 bp

>Os11t0512000-01 NAC transcription factor, Promotion of grain filling, Seed development
TCACTGCAGTGCCTTTGAGCTTTCGTTCTCTAGAGTGTCTAGGGTGAATCTTGAGCGAGT
GAGCGAGCGATCTCTGTGTTGTGTAGTTTGTGAGCTAGGGTGATGGCTAACACCGGACTT
AGCATCCCCATGGTGAATGGTGCCACAATCCACCTCCTCCCTGGTTTCCGGTTCCGTCCA
ACTGACGATGAGCTAGTCATCAAATACCTCTACCCCCGTGCTTTTCATGTGCCACTGCCC
TGTGCGATCATCACCGATGTTGACATCCATCATCACAACCCCTGGGACATCGTCCCAGTG
GCGGAGAGGGAGAAAGGGAAGCACTTCTTCACAAGAAAGGAGGTCAAGTACCCTGGTAGC
CGCCGTAGCAACCGTGTTGCTGGTAATGGCTTCTGGAGAGCAGCAGGCTCGGAGGTGCCC
ATCTATTACAAACCAGAAGGTGCTGCTAACGACATGCTAGTTGGGATGAGGCGGACTCTA
GTGTTCCACTACGGAAAGTCACGATCTGCAGAGCGCACTGAATGGGCCATGCATGAGTTT
CAGCTTGCTGGTGCTGGTCTCCTTCCTCACCCTATGATGAGGCATGCAACCAGCAATGGT
TCAGAGCCACCCTGTGGCTGCCTTGAAGCGACAATCGCTAAGAAAAGTGATGGTCTCTCT
GCAACTCTTCGTGCCAAGCGTGATTCTGCCCCTCTTATGAGAATCATGGTAGAACCCGAT
AGCTCATGGGTGATCTGCTGCATCTACAAGAAGAGGCAGCGTGCCCCGCCTGTTGTTATC
CCTCCTGTCATTGGCGATGTAGGGGAAGCTATCATCCCTCATGCTATTGGCGATGCAAGG
GAAGGCCAACTTCACTTCATTGACTTCCTGGGGCAGCCAGCTCGCAATGATCCATCCTCG
CCCCATAGCTGCACCATTGACCCCTCCTCTTTGGAGGAAGGGAGTGATGAGTCTGCCGGT
GATGGTGAAGATAAGGATGGTGATGGCATGAATGAAGCAAATTGATCGAGTGTGAAGGAA
GTGAACTGAGTCTCAAGAATAAAAACTGCAAGTATGGCGCTCCATTCCATGGAAGACCTG
CATGCATCCTATATATGTGCTTTTATGTTCAAGTTGGAGAACTATGTGTGTTGTCTTTAA
GTTGGAGTACTCTAAGCTATTCGATCTGGAGATTATGCTGTTTTTAATAAAAGTTTGAAG
TGTATCTGTCCTGTTTAATTAGTTTCAAGAAAGCCAAGCGTGTTTGGGTTCTAGGATGAA
CAAAGTCGTCCAAGATGCAAGAAGTTCTAGAGAGGTAGCTACATTTCTGGAAATTGTTGC
ATCTTCCTTTCTTCAATATATATATATTGTCCTATTTCAT

CDS

903 bp

>Os11t0512000-01 NAC transcription factor, Promotion of grain filling, Seed development
ATGGCTAACACCGGACTTAGCATCCCCATGGTGAATGGTGCCACAATCCACCTCCTCCCT
GGTTTCCGGTTCCGTCCAACTGACGATGAGCTAGTCATCAAATACCTCTACCCCCGTGCT
TTTCATGTGCCACTGCCCTGTGCGATCATCACCGATGTTGACATCCATCATCACAACCCC
TGGGACATCGTCCCAGTGGCGGAGAGGGAGAAAGGGAAGCACTTCTTCACAAGAAAGGAG
GTCAAGTACCCTGGTAGCCGCCGTAGCAACCGTGTTGCTGGTAATGGCTTCTGGAGAGCA
GCAGGCTCGGAGGTGCCCATCTATTACAAACCAGAAGGTGCTGCTAACGACATGCTAGTT
GGGATGAGGCGGACTCTAGTGTTCCACTACGGAAAGTCACGATCTGCAGAGCGCACTGAA
TGGGCCATGCATGAGTTTCAGCTTGCTGGTGCTGGTCTCCTTCCTCACCCTATGATGAGG
CATGCAACCAGCAATGGTTCAGAGCCACCCTGTGGCTGCCTTGAAGCGACAATCGCTAAG
AAAAGTGATGGTCTCTCTGCAACTCTTCGTGCCAAGCGTGATTCTGCCCCTCTTATGAGA
ATCATGGTAGAACCCGATAGCTCATGGGTGATCTGCTGCATCTACAAGAAGAGGCAGCGT
GCCCCGCCTGTTGTTATCCCTCCTGTCATTGGCGATGTAGGGGAAGCTATCATCCCTCAT
GCTATTGGCGATGCAAGGGAAGGCCAACTTCACTTCATTGACTTCCTGGGGCAGCCAGCT
CGCAATGATCCATCCTCGCCCCATAGCTGCACCATTGACCCCTCCTCTTTGGAGGAAGGG
AGTGATGAGTCTGCCGGTGATGGTGAAGATAAGGATGGTGATGGCATGAATGAAGCAAAT
TGA

Protein

301 aa

>Os11t0512000-01 NAC transcription factor, Promotion of grain filling, Seed development
MANTGLSIPMVNGATIHLLPGFRFRPTDDELVIKYLYPRAFHVPLPCAIITDVDIHHHNP
WDIVPVAEREKGKHFFTRKEVKYPGSRRSNRVAGNGFWRAAGSEVPIYYKPEGAANDMLV
GMRRTLVFHYGKSRSAERTEWAMHEFQLAGAGLLPHPMMRHATSNGSEPPCGCLEATIAK
KSDGLSATLRAKRDSAPLMRIMVEPDSSWVICCIYKKRQRAPPVVIPPVIGDVGEAIIPH
AIGDAREGQLHFIDFLGQPARNDPSSPHSCTIDPSSLEEGSDESAGDGEDKDGDGMNEAN
*

5'UTR

chr11:18288358..18288459 (+ strand) : 102 bp

CDS

chr11:18288460..18288655 (+ strand) : 196 bp

chr11:18288824..18289167 (+ strand) : 344 bp

chr11:18290003..18290365 (+ strand) : 363 bp

3'UTR

chr11:18290366..18290720 (+ strand) : 355 bp

FASTA

>Os11t0512000-01 class=Sequence position=chr11:18288358..18290720 (+ strand)
TCACTGCAGT GCCTTTGAGC TTTCGTTCTC TAGAGTGTCT AGGGTGAATC TTGAGCGAGT GAGCGAGCGA TCTCTGTGTT
GTGTAGTTTG TGAGCTAGGG TGATGGCTAA CACCGGACTT AGCATCCCCA TGGTGAATGG TGCCACAATC CACCTCCTCC
CTGGTTTCCG GTTCCGTCCA ACTGACGATG AGCTAGTCAT CAAATACCTC TACCCCCGTG CTTTTCATGT GCCACTGCCC
TGTGCGATCA TCACCGATGT TGACATCCAT CATCACAACC CCTGGGACAT CGTCCCAGGT TAATTTTGAT ATGCACTTCT
TTGCTTCTAT GAAAATTATT ACCACATCCG TCTGCATATA TCTCTGATTT GACTGATTAA TTGCATGTGT GTCCTGACGA
TATTTATTCT CTTGTTTTGT TTATCATTTT TTTCGTTTGT TCGTTGGCAA CGATCTGATG ATGAAGTGGC GGAGAGGGAG
AAAGGGAAGC ACTTCTTCAC AAGAAAGGAG GTCAAGTACC CTGGTAGCCG CCGTAGCAAC CGTGTTGCTG GTAATGGCTT
CTGGAGAGCA GCAGGCTCGG AGGTGCCCAT CTATTACAAA CCAGAAGGTG CTGCTAACGA CATGCTAGTT GGGATGAGGC
GGACTCTAGT GTTCCACTAC GGAAAGTCAC GATCTGCAGA GCGCACTGAA TGGGCCATGC ATGAGTTTCA GCTTGCTGGT
GCTGGTCTCC TTCCTCACCC TATGATGAGG CATGCAACCA GCAATGGTTC AGAGCCACCC TGTGGCTGCC TTGAAGCGAC
AATCGCTAAG GTGAGATGCT ACGTCCAAAA ATTTTACTGT TCCATTTATC ATGATTCCAT CTAAATGCCT GTTGAATTAA
ATTGCTCAAT TATTTGGATA GGTTGGATTA TGAGTTTTAG CTTTAGGGAA TGGGGAAAAT ATGATGACTT AGTATACGTG
ATGATATACT ATAACTCTTG TGTTGATTTA TTAAATAAGG GAAGGGTAGT TGTTTTCGAT CTTAGGACTA AGGGTACGTG
ACGCTTGATA TAGGGTTCAT TTATTGTTGC CATGCAAGAT GCGCGGGATC TAGAAGTGAT TCAAATTTTG TCGTGACAAG
GAATCTAGAG GTGGTGGGCC TGCTGATTTG AATTTGTCAT AGCCTCACAT GGTTTTCCTT ATGTATTACT AGGATGTAAT
GATGATTAAT TGATTTTGCC GTGAAGCGAG ATCTAGCGGT TACAAGATCT ACTAGTGATT CAAATATATT GAGAAAAAAA
GGGGTTTGCT GTCTACTTGC ATTTTCAGTA GGGAACCTCT TTATTGAACA CCACGTGTCA TGATACACTT GATACTGGGA
TATTTGGATT TGTACATCTG GTTTTAATTT GATCATTGCC ACAAGATTTA TATAAGTGAC ATGTCAACAG TTTACTTCTC
AAATTAGTTG CAACATTCAA ACTGGACATG AAGTTATCAC ACATCTTTCT AATTCAGTCC CCATATGATT TGTCACAGTA
AGAGGCTTAT AAACTAGTTT ACTATAATGG TCAATTCATC TATTCTCTTT GTTGTATATG TTGTATATAC CATGGTTGCA
CCTTAAGTAG ATCCACTAAC AGACAAAATG GTGTCTATTT TACAGAAAAG TGATGGTCTC TCTGCAACTC TTCGTGCCAA
GCGTGATTCT GCCCCTCTTA TGAGAATCAT GGTAGAACCC GATAGCTCAT GGGTGATCTG CTGCATCTAC AAGAAGAGGC
AGCGTGCCCC GCCTGTTGTT ATCCCTCCTG TCATTGGCGA TGTAGGGGAA GCTATCATCC CTCATGCTAT TGGCGATGCA
AGGGAAGGCC AACTTCACTT CATTGACTTC CTGGGGCAGC CAGCTCGCAA TGATCCATCC TCGCCCCATA GCTGCACCAT
TGACCCCTCC TCTTTGGAGG AAGGGAGTGA TGAGTCTGCC GGTGATGGTG AAGATAAGGA TGGTGATGGC ATGAATGAAG
CAAATTGATC GAGTGTGAAG GAAGTGAACT GAGTCTCAAG AATAAAAACT GCAAGTATGG CGCTCCATTC CATGGAAGAC
CTGCATGCAT CCTATATATG TGCTTTTATG TTCAAGTTGG AGAACTATGT GTGTTGTCTT TAAGTTGGAG TACTCTAAGC
TATTCGATCT GGAGATTATG CTGTTTTTAA TAAAAGTTTG AAGTGTATCT GTCCTGTTTA ATTAGTTTCA AGAAAGCCAA
GCGTGTTTGG GTTCTAGGAT GAACAAAGTC GTCCAAGATG CAAGAAGTTC TAGAGAGGTA GCTACATTTC TGGAAATTGT
TGCATCTTCC TTTCTTCAAT ATATATATAT TGTCCTATTT CAT

Locus: Os11g0512000

Loading...

Locus: Os11g0512000

Loading...