Os11t0523800-01

Locus

Os11g0523800

Description

Similar to Isoform 3 of Auxin response factor 23.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARF1

CGSNL Gene Name

AUXIN RESPONSE FACTOR 1

Oryzabase Gene Symbol Synonym(s)

OsARF1, arf1, OsARF23, ARF23

Oryzabase Gene Name Synonym(s)

auxin response factor-1, auxin response factor 1, auxin response factor-23, auxin response factor 23

Transcript Evidence

AK065936 (DDBJ, Best hit)

Protein Evidence

Q2R3F5-3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Biological Process: response to hormone stimulus (GO:0009725)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Transcriptional factor B3 (IPR003340)

Auxin response factor (IPR010525)

DNA-binding pseudobarrel domain (IPR015300)

Full-length cDNA

J013045A03 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0523800-01)

RiceXPro (AK065936)

Others

Oryzabase (6089)

KEGG (Os11t0523800-01)

Transcript

3337 bp

>Os11t0523800-01 Similar to Isoform 3 of Auxin response factor 23.
GTTTTTTTTTTCTTCTTTTTTCTCGCTTAAATTCACCCAGTAAAAAAAAAATTTAAAACA
AAAGAGAGGAGAGGAGAGGAAGAAGAGGAGGTGGTGGAGGAGGAGGAGGAGAAGCTGCTT
GTGCTGCTGCTGCGAATCGGAGGGGAATTCGAGGGGGCGGGGGGCGCGAATCCGGCGGGG
GAATTCGCGCGATTCGGGCGTGGCCGCGGGGGATGTGAAGATCTGGTGGGGTGATGGCGA
CGGCGGAGGTCGGCGGCGGCGGCGGTGAGGGGGATGCTGCTGCCGCGGCGGTGGCGCGAG
GCGGCGGCGGCGGAGGAGGAGGAGGAGGAGGGGAGGACGCGCTGTTCACGGAGCTGTGGA
GCGCGTGCGCGGGGCCGCTGGTGACGGTGCCGAGGGTTGGGGAGAAGGTGTTCTACTTCC
CGCAGGGGCACATCGAGCAGGTGGAGGCCTCGACCAACCAGGTAGGCGAGCAGCGGATGC
AGTTGTACAATCTCCCATGGAAGATCCTGTGTGAGGTTATGAACGTTGAGCTGAAGGCCG
AGCCAGACACCGACGAGGTTTATGCTCAGCTCACTCTGCTTCCTGAATCGAAGCAACAAG
AAGATAACGGCTCTACTGAGGAGGAGGTGCCTTCTGCTCCAGCAGCTGGGCATGTTAGGC
CACGGGTGCACTCATTCTGCAAGACATTGACCGCCTCGGACACGAGCACACATGGCGGCT
TCTCGGTGCTGCGACGCCACGCGGACGAATGCCTCCCACCACTGGATATGAGCCGTCAGC
CTCCAACACAAGAGCTGGTGGCCAAGGATCTGCACGGTGTGGAATGGCGCTTTCGTCACA
TATTCAGAGGTCAACCACGAAGACACCTTTTGCAGAGTGGCTGGAGTGTGTTTGTTAGTG
CCAAACGGCTTGTTGCTGGGGATGCCTTTATCTTTCTCAGAGGTGAGAACGGGGAACTGC
GTGTTGGAGTCAGGCGTGCAATGAGGCAGCAAACTAATGTTCCATCTTCAGTGATATCAA
GCCACAGCATGCATCTTGGGGTTCTTGCCACAGCATGGCATGCTGTTAACACAGGGACCA
TGTTCACTGTCTACTACAAGCCTAGGACAAGTCCAGCCGAGTTTGTGGTCCCTTACGATC
GCTATATGGAATCACTGAAACAAAATTACTCCATTGGGATGAGATTTAAGATGAGGTTTG
AAGGTGAAGAGGCTCCAGAGCAAAGATTCACTGGGACTATTGTCGGAATGGGGGATTCTG
ATCCAGCTGGCTGGCCTGAATCAAAATGGCGCTCCCTTAAGGTTTATTTCTTTCGCCACT
TTCCATTTAAATAACATTTATTTTCTGAGAATTTCTTACAGATTTTTGTGTTACTTAGGT
GAGATGGGATGAAGCTTCTTCCATACCTCGCCCTGAAAGAGTTTCTCCCTGGCAAATAGA
ACCTGCTGTAAGCCCTCCTCCTGTCAACCCACTACCAGTTCCAAGAACCAAGAGGCTTCG
TCCGAATGCTACCGCTTTGCCGGCTGACTCTTCTGCTATAGCAAAAGAAGCTGCTACGAA
AGTTGTGGTCGAGTCTGAACCAAATGGTACGCAAAGGACCTTCCAGACACAAGAGAATGC
AACCCCAAAAAGTGGTTTCGGCAATAGCAGCGAGTTAGAAAGTGCTCAGAAATCAATCAT
GCGTCCATCTGGATTTGATCGTGAGAAAAATAACACTCCCATACAGTGGAAGCTAGGTTC
AGATGGTCGGATGCAGATGAGCAAGCCTGAGAGTTACAGTGAGATGCTATCTGGATTTCA
GCCACCTAAAGATGTACAAATCCCACAGGGTTTCTGTTCTTTACCTGAGCAGATTACTGC
AGGCCATTCTAACTTCTGGCACACAGTAAATGCTCAGTATCAAGATCAACAGAGCAATCA
CAATATGTTCCCCAGCTCATGGTCCTTCATGCCTCCAAATACTCGCCTTGGATTAAACAA
ACAGAACTATTCAATGATTCAGGAAGCTGGTGTGTTGTCTCAAAGGCCTGGAAATACAAA
GTTTGGGAATGGAGTTTATGCTGCACTGCCAGGCCGAGGTACTGAGCAATACTCAGGGGG
TTGGTTTGGCCATATGATGCCAAATTCCCACATGGATGATACACAGCCACGCCTGATCAA
GCCTAAACCTCTGGTTGTTGCCCATGGTGATGTTCAGAAAGCTAAAGGTGCTTCATGCAA
ACTATTTGGAATTCACCTTGACAGCCCAGCGAAATCTGAACCTTTGAAATCTCCATCAAG
TGTTGTATATGATGGGACGCCACAAACACCAGGTGCTACTGAATGGCGCCGACCAGATGT
AACTGAAGTAGAGAAATGTTCTGATCCTTCTAAGGCCATGAAGCCACTTGATACTCCGCA
ACCAGACTCTGTTCCTGAGAAGCCTTCTTCTCAGCAAGCTTCACGAAACATGTCGTGCAA
ATCACAAGGTGTATCAACTAGAAGCTGCAAGAAGGTCCACAAGCAAGGCATTGCACTTGG
CAGGTCTGTGGACCTTACAAAGTTTAATGGCTATGAAGAGTTGATTGCTGAGCTGGATGA
CATGTTTGATTTCAATGGTGAACTGAAGGGTCCTAAGAAGGAGTGGATGGTTGTCTACAC
TGACAACGAAGGTGACATGATGCTAGTTGGGGATGATCCCTGGATTGAATTCTGCGACAT
GGTTCACAAGATCTTCATCTACACAAGAGAAGAGGTTCAGCGGATGAATCCGGGAACCCT
GAACTCAAGATCAGAAGATAGTCATGCTAATTCAATGGAAAGGGGCTCAGTCGGCAGAGA
AATGCGAGGCTGCTTGTCAACCTCGTCTCTTAATTCTGAGAACTGCTAATGCTTTCCCAT
CTGGTCTTTTGAAGTAACATGGGAGACAAGAACGCGATGCATCGTTATAAGAAAATGCAT
TTCGTAGTGGAGTTAATGCTTTTTTTCCCCCTTTGATGTATTGGATAAGCTCAAAGTACC
CTATTTGTAGATGGTGCTTGTCCTTGGTGGTCAAGTTGCACTCTTATTTGCTGCAGTTTT
GGTTTTCTATTTTGGTGAGGTAAGTTGTCAGCCGCCAGTCCTACCATATAAATGTTGGTA
TGCGTAGAAAAGTAAGCTCAGCCCTCCCACCCTGCACTTCCTCTCTCTCAGCACTAAGCT
GCCACCTCCTTGTAAATAGCCCCTGTTTAATTGAGTCTAATATATTATCTACCTTAACTG
ACATTCCTTTGTTTCATCTTGCTAAATTATAGCAGTAGCCTGGTAAGATTATTGTAGCCC
AAATTAACATGTGATCTGAGATTTTATTTTTGCTTTC

CDS

1101 bp

>Os11t0523800-01 Similar to Isoform 3 of Auxin response factor 23.
ATGGCGACGGCGGAGGTCGGCGGCGGCGGCGGTGAGGGGGATGCTGCTGCCGCGGCGGTG
GCGCGAGGCGGCGGCGGCGGAGGAGGAGGAGGAGGAGGGGAGGACGCGCTGTTCACGGAG
CTGTGGAGCGCGTGCGCGGGGCCGCTGGTGACGGTGCCGAGGGTTGGGGAGAAGGTGTTC
TACTTCCCGCAGGGGCACATCGAGCAGGTGGAGGCCTCGACCAACCAGGTAGGCGAGCAG
CGGATGCAGTTGTACAATCTCCCATGGAAGATCCTGTGTGAGGTTATGAACGTTGAGCTG
AAGGCCGAGCCAGACACCGACGAGGTTTATGCTCAGCTCACTCTGCTTCCTGAATCGAAG
CAACAAGAAGATAACGGCTCTACTGAGGAGGAGGTGCCTTCTGCTCCAGCAGCTGGGCAT
GTTAGGCCACGGGTGCACTCATTCTGCAAGACATTGACCGCCTCGGACACGAGCACACAT
GGCGGCTTCTCGGTGCTGCGACGCCACGCGGACGAATGCCTCCCACCACTGGATATGAGC
CGTCAGCCTCCAACACAAGAGCTGGTGGCCAAGGATCTGCACGGTGTGGAATGGCGCTTT
CGTCACATATTCAGAGGTCAACCACGAAGACACCTTTTGCAGAGTGGCTGGAGTGTGTTT
GTTAGTGCCAAACGGCTTGTTGCTGGGGATGCCTTTATCTTTCTCAGAGGTGAGAACGGG
GAACTGCGTGTTGGAGTCAGGCGTGCAATGAGGCAGCAAACTAATGTTCCATCTTCAGTG
ATATCAAGCCACAGCATGCATCTTGGGGTTCTTGCCACAGCATGGCATGCTGTTAACACA
GGGACCATGTTCACTGTCTACTACAAGCCTAGGACAAGTCCAGCCGAGTTTGTGGTCCCT
TACGATCGCTATATGGAATCACTGAAACAAAATTACTCCATTGGGATGAGATTTAAGATG
AGGTTTGAAGGTGAAGAGGCTCCAGAGCAAAGATTCACTGGGACTATTGTCGGAATGGGG
GATTCTGATCCAGCTGGCTGGCCTGAATCAAAATGGCGCTCCCTTAAGGTTTATTTCTTT
CGCCACTTTCCATTTAAATAA

Protein

367 aa

>Os11t0523800-01 Similar to Isoform 3 of Auxin response factor 23.
MATAEVGGGGGEGDAAAAAVARGGGGGGGGGGGEDALFTELWSACAGPLVTVPRVGEKVF
YFPQGHIEQVEASTNQVGEQRMQLYNLPWKILCEVMNVELKAEPDTDEVYAQLTLLPESK
QQEDNGSTEEEVPSAPAAGHVRPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMS
RQPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGENG
ELRVGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRTSPAEFVVP
YDRYMESLKQNYSIGMRFKMRFEGEEAPEQRFTGTIVGMGDSDPAGWPESKWRSLKVYFF
RHFPFK*

5'UTR

chr11:18941454..18941686 (- strand) : 233 bp

CDS

chr11:18941387..18941453 (- strand) : 67 bp

chr11:18941146..18941285 (- strand) : 140 bp

chr11:18940213..18940308 (- strand) : 96 bp

chr11:18940074..18940130 (- strand) : 57 bp

chr11:18939796..18939966 (- strand) : 171 bp

chr11:18939596..18939680 (- strand) : 85 bp

chr11:18938971..18939061 (- strand) : 91 bp

chr11:18938718..18938882 (- strand) : 165 bp

chr11:18938421..18938540 (- strand) : 120 bp

chr11:18938222..18938330 (- strand) : 109 bp

3'UTR

chr11:18938006..18938221 (- strand) : 216 bp

chr11:18936984..18937927 (- strand) : 944 bp

chr11:18936242..18936432 (- strand) : 191 bp

chr11:18935953..18936150 (- strand) : 198 bp

chr11:18935399..18935852 (- strand) : 454 bp

FASTA

>Os11t0523800-01 class=Sequence position=chr11:18935399..18941686 (- strand)
GTTTTTTTTT TCTTCTTTTT TCTCGCTTAA ATTCACCCAG TAAAAAAAAA ATTTAAAACA AAAGAGAGGA GAGGAGAGGA
AGAAGAGGAG GTGGTGGAGG AGGAGGAGGA GAAGCTGCTT GTGCTGCTGC TGCGAATCGG AGGGGAATTC GAGGGGGCGG
GGGGCGCGAA TCCGGCGGGG GAATTCGCGC GATTCGGGCG TGGCCGCGGG GGATGTGAAG ATCTGGTGGG GTGATGGCGA
CGGCGGAGGT CGGCGGCGGC GGCGGTGAGG GGGATGCTGC TGCCGCGGCG GTGGCGCGAG GTGAGCTCCT CTCGGTGGTG
GGTGGGCGTG TGTGGGTTTG CGCGTGGGTT TTTTGTGGGC TGGCTTGTGA TGCCGGCTTT TGGGCTTTGG GCTTGCAGCA
GGCGGCGGCG GCGGAGGAGG AGGAGGAGGA GGGGAGGACG CGCTGTTCAC GGAGCTGTGG AGCGCGTGCG CGGGGCCGCT
GGTGACGGTG CCGAGGGTTG GGGAGAAGGT GTTCTACTTC CCGCAGGGGC ACATCGAGCA GGTGAGTCCG AGTCCGAGCT
CGAGGTCGAG CAGAGCGCGC GCCGCCCAAT TCGGGCGCGG GGTGGTGGCG GTGGCGGCGG CCGCCTTTCT CGCCTCTCCG
CGATTCCCCG CTTTTTATTA GAGAGTTTAT TAGTTCCATT TCGATTTCTC TTCCTGGTCC TTTTCCGCCG TTTGATTTTG
AGAGTTTTTT TGGTTTTCAA CTCTCTTTTC TCTCTCTTCG TGTTTCTGTT GATCCGAGTG GCGTCTTCGG GTTTGAGCTG
TTTTGAAGCC ACTCGTTTTT TTTCTTCTTG ACTTGTTCAA ATGCTTGAGG TTTTGGTGTT TATGCGTCCT AGCGGCGATG
GGAATCTTTT AAGATAAATT TTGGGGGGAA TTTGTCTGTG CCGTTGGCGA ATTTCGCTTT CTTGAGTTTG TGTCGTGGAA
TTTTGGCGGG TTTTGAGCAT TTTTGGTGAT GCGGTTTTGG GGTTTACGTT TTGCCTCTCT AAAATTCGAA GTTTTTTCCA
AGTTTTTTCG GTTATACTGT ATGCAATTCT CTGGTTCGAA CTAAGTTTCC GAGTTGTCGC AGTTGCTGAG TGTGAGATTG
GAACTATTTG AATGGGGAAT TCTGTAGTTT TTGTGCCGGA TCGCTTCGCC TATGAGTCGA ATTCGGCTTC TTGGTTGCCA
AAATTCGGAA TTCTGTGTTT TACTTCGCAA AAGAAAAAAA AACTGGGGAT TTTCGTGCTT GGTACTGAAC TAGTGATAAT
TTGTTCTTCC TGCATTCTTG CAAATGTATT TTTTTTCTTG GCTGGAATCA GTGTTTCGGT GGCTGATTTT GGAATTCTTT
GCCTCTGTCC ATTTTCAGGT GGAGGCCTCG ACCAACCAGG TAGGCGAGCA GCGGATGCAG TTGTACAATC TCCCATGGAA
GATCCTGTGT GAGGTTATGA ACGTTGAGCT GAAGGTACTT GCTTTGTGTT TCTTGTGAAT TCTGAGAGCT TTCATTCTTG
GTTGTATGTG TGGTTGACAT ATAGCTCTGT TTGTAGGCCG AGCCAGACAC CGACGAGGTT TATGCTCAGC TCACTCTGCT
TCCTGAATCG AAGGTAAAAA AAAAAATGTC TCCAGTTTGC ACGCTGTCAC TGCTTCATAC ATTCCGGGAT AGAAGTTTTG
AGCGTTTTGA AAGGAAAAAA AATGTTGGTC TGTTGTGTAG CAACAAGAAG ATAACGGCTC TACTGAGGAG GAGGTGCCTT
CTGCTCCAGC AGCTGGGCAT GTTAGGCCAC GGGTGCACTC ATTCTGCAAG ACATTGACCG CCTCGGACAC GAGCACACAT
GGCGGCTTCT CGGTGCTGCG ACGCCACGCG GACGAATGCC TCCCACCACT GGTTCGTCCC ACTGGTTCTT TGACTTGATG
TTGTTTTCAG TGATGTACTT GTAGTCCTAG GTCTTACTAG GATGCTTGAG TTGTAGTGAT GATCTTTGCT TTGGCTTCTT
GATCAGGATA TGAGCCGTCA GCCTCCAACA CAAGAGCTGG TGGCCAAGGA TCTGCACGGT GTGGAATGGC GCTTTCGTCA
CATATTCAGA GGTGATCACT CTTCCAACAT CGTACTTATT TCTCTATTTT CTGAAGGACG TGTGATGCTC ACTGCTCTTT
GCTAATGAAC ACAAGTTTCC ATGATATCAT GACTAGGAGA CATCTTTACA CTGCTCTTGG GTTGATCGTA TAGTGTAAGA
ACAGTTCTTG CATTTGACTA ACCCCTTCAT TTATAATATT GGTATTAAAT GCACTTTTTT GGTACGATGC CTATCCCGTA
TTATCTTGAT GGCTTTATTA GAGGGACCAG TTTGTGCTTC CCACAATTTC TTGTGCATTT TTGTTCTTTG CATGGGCCTA
CACTTGATGG AGTATGGATA ACTACAACTT TTGTTGGTTG ATGCTGCAGT GGTCGTGCTC TAGTTTCTTA GGACAAGTAG
TTTATGCTTT CATATGCCCT TGTGATGTAA GAGTTGTGCT AATTGATTAT GTTGTCCTGC CCGAGTTTCG ATTGCACCTA
GGTTAGAAGG AAGTTAATTT TTTGCTTCAA CTCTTCTTGA GCTATATCTT TTTGATCAAC ATCAGGTCAA CCACGAAGAC
ACCTTTTGCA GAGTGGCTGG AGTGTGTTTG TTAGTGCCAA ACGGCTTGTT GCTGGGGATG CCTTTATCTT TCTCAGGTTT
GATAATTTGA CACAGTGTTT GCTTTGTCTA CCTGTGCTTT CCCCTGTACT GCTTAATAAA TATCCCCCTA TATGATCTGC
ACAGAGGTGA GAACGGGGAA CTGCGTGTTG GAGTCAGGCG TGCAATGAGG CAGCAAACTA ATGTTCCATC TTCAGTGATA
TCAAGCCACA GCATGCATCT TGGGGTTCTT GCCACAGCAT GGCATGCTGT TAACACAGGG ACCATGTTCA CTGTCTACTA
CAAGCCTAGG TTTGTTGTGA AGTTTTTCTG GATTTTATGC ACATGATTTT ATTTATGCAC TTTGGGAGCA TTGTCTGTTT
ACTTGTCACC TGAATTCTGA ACTGATCTTG CTATGTGATA GAATTAAATT TGTCCGATTG TGCTAGCACT TAAACGCTAT
CGCTGAAATC TTCTATTTTT CATCAGGACA AGTCCAGCCG AGTTTGTGGT CCCTTACGAT CGCTATATGG AATCACTGAA
ACAAAATTAC TCCATTGGGA TGAGATTTAA GATGAGGTTT GAAGGTGAAG AGGCTCCAGA GCAAAGGTAG CACTTAGATG
GATATGCATT CTACTTTTGA CAGGTGATTC CTCTGTATCT GAATCAACCG ATTAATCTTT AATGCTCATG CATTAGATTC
ACTGGGACTA TTGTCGGAAT GGGGGATTCT GATCCAGCTG GCTGGCCTGA ATCAAAATGG CGCTCCCTTA AGGTTTATTT
CTTTCGCCAC TTTCCATTTA AATAACATTT ATTTTCTGAG AATTTCTTAC AGATTTTTGT GTTACTTAGG TGAGATGGGA
TGAAGCTTCT TCCATACCTC GCCCTGAAAG AGTTTCTCCC TGGCAAATAG AACCTGCTGT AAGCCCTCCT CCTGTCAACC
CACTACCAGT TCCAAGAACC AAGAGGCTTC GTCCGAATGC TACCGCTTTG CCGGCTGACT CTTCTGCTAT AGCAAAAGAA
GGTCAGACCT TGTCATCAAT ATGAAATCTA CAGTATAGCT TCGTTGTCTT TACTAATGCA CGTCTTTTCT TCAATCTAGC
TGCTACGAAA GTTGTGGTCG AGTCTGAACC AAATGGTACG CAAAGGACCT TCCAGACACA AGAGAATGCA ACCCCAAAAA
GTGGTTTCGG CAATAGCAGC GAGTTAGAAA GTGCTCAGAA ATCAATCATG CGTCCATCTG GATTTGATCG TGAGAAAAAT
AACACTCCCA TACAGTGGAA GCTAGGTTCA GATGGTCGGA TGCAGATGAG CAAGCCTGAG AGTTACAGTG AGATGCTATC
TGGATTTCAG CCACCTAAAG ATGTACAAAT CCCACAGGGT TTCTGTTCTT TACCTGAGCA GATTACTGCA GGCCATTCTA
ACTTCTGGCA CACAGTAAAT GCTCAGTATC AAGATCAACA GAGCAATCAC AATATGTTCC CCAGCTCATG GTCCTTCATG
CCTCCAAATA CTCGCCTTGG ATTAAACAAA CAGAACTATT CAATGATTCA GGAAGCTGGT GTGTTGTCTC AAAGGCCTGG
AAATACAAAG TTTGGGAATG GAGTTTATGC TGCACTGCCA GGCCGAGGTA CTGAGCAATA CTCAGGGGGT TGGTTTGGCC
ATATGATGCC AAATTCCCAC ATGGATGATA CACAGCCACG CCTGATCAAG CCTAAACCTC TGGTTGTTGC CCATGGTGAT
GTTCAGAAAG CTAAAGGTGC TTCATGCAAA CTATTTGGAA TTCACCTTGA CAGCCCAGCG AAATCTGAAC CTTTGAAATC
TCCATCAAGT GTTGTATATG ATGGGACGCC ACAAACACCA GGTGCTACTG AATGGCGCCG ACCAGATGTA ACTGAAGTAG
AGAAATGTTC TGATCCTTCT AAGGCCATGA AGCCACTTGA TACTCCGCAA CCAGACTCTG TTCCTGAGAA GCCTTCTTCT
CAGCAAGCTT CACGAAACAT GTCGTGCAAA TCACAAGGTG TATCAACTAG AAGCTGCAAG AAGGTACCAC TTTCTTGTTA
TTATTGCACT TATCACCTCT TTGCAATCTC CAAGTTCTTC CTTGTGAATG ATTTTAAATA ATTCTCCAAC AAGTTTTCCT
CCCCTCCTAG ATATGCCCAA TAAGATTAAT TTTGGAGCAC CTTTGGATAt acttcctccg tttcatatta taagactttc
tagcattgcc cacattcata tatatatata tgttaataaa tctagacata tatgtgtgcc tatattcttt aacatctata
tgaatgtagg caatgctaga aagtcttata acctgaaacg gaggtagtaT TATATTTCAA AGGTCCAAAT GTACAAACTT
GCTCAGTATT TTTTTTTGCC AAAGTTAATA TAGCTCAACT CATTCTCTAA TCTCTCCTAT AGATGCATAA TCAAACCCTT
GTTTCTTACA TATAATCTTT CCTTCGGAAG CATGTTTGGC ACTACTTATA CCATCCTCAA GTGCTCAGCT TAATTATTTT
TTCTAGATTT TCCCTGTTTT CCAACATGAT GGTTGATAAA CTATACATTT CCAGGTCCAC AAGCAAGGCA TTGCACTTGG
CAGGTCTGTG GACCTTACAA AGTTTAATGG CTATGAAGAG TTGATTGCTG AGCTGGATGA CATGTTTGAT TTCAATGGTG
AACTGAAGGG TCCTAAGAAG GAGTGGATGG TTGTCTACAC TGACAACGAA GGTGACATGA TGCTAGTTGG GGATGATCCC
TGGATGTGAG TTAACTCATA AATGCTTTCC TCATTCGCTG ATCTGATTTA ATGACATCAC AAATGCTGAC TGCATCGGAC
AATCATTCTT GAACAGTGAA TTCTGCGACA TGGTTCACAA GATCTTCATC TACACAAGAG AAGAGGTTCA GCGGATGAAT
CCGGGAACCC TGAACTCAAG ATCAGAAGAT AGTCATGCTA ATTCAATGGA AAGGGGCTCA GTCGGCAGAG AAATGCGAGG
CTGCTTGTCA ACCTCGTCTC TTAATTCTGA GAACTGCTAA TGCTTTCCCA TCTGGTAACG TGAGTAGTGG CATTTCACCT
TTCTTCACTA TAACTAGTAA AGTATAAACG GCCTCCGGTG CTCATCTTTG TTCCATCATC TTGCTTTCTG GCAGGTCTTT
TGAAGTAACA TGGGAGACAA GAACGCGATG CATCGTTATA AGAAAATGCA TTTCGTAGTG GAGTTAATGC TTTTTTTCCC
CCTTTGATGT ATTGGATAAG CTCAAAGTAC CCTATTTGTA GATGGTGCTT GTCCTTGGTG GTCAAGTTGC ACTCTTATTT
GCTGCAGTTT TGGTTTTCTA TTTTGGTGAG GTAAGTTGTC AGCCGCCAGT CCTACCATAT AAATGTTGGT ATGCGTAGAA
AAGTAAGCTC AGCCCTCCCA CCCTGCACTT CCTCTCTCTC AGCACTAAGC TGCCACCTCC TTGTAAATAG CCCCTGTTTA
ATTGAGTCTA ATATATTATC TACCTTAACT GACATTCCTT TGTTTCATCT TGCTAAATTA TAGCAGTAGC CTGGTAAGAT
TATTGTAGCC CAAATTAACA TGTGATCTGA GATTTTATTT TTGCTTTC

Locus: Os11g0523800

Loading...

Locus: Os11g0523800

Loading...