Os11t0523800-02

Locus

Os11g0523800

Description

Auxin response factor 1, Transcription factor, Essential for growth in vegetative organs and seed development

RAP-DB Gene Symbol Synonym(s)

OsARF1

RAP-DB Gene Name Synonym(s)

auxin response factor 1

CGSNL Gene Symbol

ARF1

CGSNL Gene Name

AUXIN RESPONSE FACTOR 1

Oryzabase Gene Symbol Synonym(s)

OsARF1, arf1, OsARF23, ARF23

Oryzabase Gene Name Synonym(s)

auxin response factor-1, auxin response factor 1, auxin response factor-23, auxin response factor 23

Transcript Evidence

AJ306306

Protein Evidence

Q2R3F5-3

Literature

PMID: 19193962

PMID: 12369618

Note

Manual Curation

November 17, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Biological Process: response to hormone (GO:0009725)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

DNA-binding pseudobarrel domain superfamily (IPR015300)

B3 DNA binding domain (IPR003340)

Auxin response factor (IPR010525)

PB1 domain (IPR000270)

AUX/IAA domain (IPR033389)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Others

Oryzabase (6089)

Transcript

2511 bp

>Os11t0523800-02 Auxin response factor 1, Transcription factor, Essential for growth in vegetative organs and seed development
ATGGCGACGGCGGAGGTCGGCGGCGGCGGCGGAGGAGGAGGAGGAGGAGGGGAGGACGCG
CTGTTCACGGAGCTGTGGAGCGCGTGCGCGGGGCCGCTGGTGACGGTGCCGAGGGTTGGG
GAGAAGGTGTTCTACTTCCCGCAGGGGCACATCGAGCAGGTGGAGGCCTCGACCAACCAG
GTAGGCGAGCAGCGGATGCAGTTGTACAATCTCCCATGGAAGATCCTGTGTGAGGTTATG
AACGTTGAGCTGAAGGCCGAGCCAGACACCGACGAGGTTTATGCTCAGCTCACTCTGCTT
CCTGAATCGAAGCAACAAGAAGATAACGGCTCTACTGAGGAGGAGGTGCCTTCTGCTCCA
GCAGCTGGGCATGTTAGGCCACGGGTGCACTCATTCTGCAAGACATTGACCGCCTCGGAC
ACGAGCACACATGGCGGCTTCTCGGTGCTGCGACGCCACGCGGACGAATGCCTCCCACCA
CTGGATATGAGCCGTCAGCCTCCAACACAAGAGCTGGTGGCCAAGGATCTGCACGGTGTG
GAATGGCGCTTTCGTCACATATTCAGAGGTCAACCACGAAGACACCTTTTGCAGAGTGGC
TGGAGTGTGTTTGTTAGTGCCAAACGGCTTGTTGCTGGGGATGCCTTTATCTTTCTCAGA
GGTGAGAACGGGGAACTGCGTGTTGGAGTCAGGCGTGCAATGAGGCAGCAAACTAATGTT
CCATCTTCAGTGATATCAAGCCACAGCATGCATCTTGGGGTTCTTGCCACAGCATGGCAT
GCTGTTAACACAGGGACCATGTTCACTGTCTACTACAAGCCTAGGACAAGTCCAGCCGAG
TTTGTGGTCCCTTACGATCGCTATATGGAATCACTGAAACAAAATTACTCCATTGGGATG
AGATTTAAGATGAGGTTTGAAGGTGAAGAGGCTCCAGAGCAAAGATTCACTGGGACTATT
GTCGGAATGGGGGATTCTGATCCAGCTGGCTGGCCTGAATCAAAATGGCGCTCCCTTAAG
GTGAGATGGGATGAAGCTTCTTCCATACCTCGCCCTGAAAGAGTTTCTCCCTGGCAAATA
GAACCTGCTGTAAGCCCTCCTCCTGTCAACCCACTACCAGTTCCAAGAACCAAGAGGCTT
CGTCCGAATGCTACCGCTTTGCCGGCTGACTCTTCTGCTATAGCAAAAGAAGCTGCTACG
AAAGTTGTGGTCGAGTCTGAACCAAATGGTACGCAAAGGACCTTCCAGACACAAGAGAAT
GCAACCCCAAAAAGTGGTTTCGGCAATAGCAGCGAGTTAGAAAGTGCTCAGAAATCAATC
ATGCGTCCATCTGGATTTGATCGTGAGAAAAATAACACTCCCATACAGTGGAAGCTAGGT
TCAGATGGTCGGATGCAGATGAGCAAGCCTGAGAGTTACAGTGAGATGCTATCTGGATTT
CAGCCACCTAAAGATGTACAAATCCCACAGGGTTTCTGTTCTTTACCTGAGCAGATTACT
GCAGGCCATTCTAACTTCTGGCACACAGTAAATGCTCAGTATCAAGATCAACAGAGCAAT
CACAATATGTTCCCCAGCTCATGGTCCTTCATGCCTCCAAATACTCGCCTTGGATTAAAC
AAACAGAACTATTCAATGATTCAGGAAGCTGGTGTGTTGTCTCAAAGGCCTGGAAATACA
AAGTTTGGGAATGGAGTTTATGCTGCACTGCCAGGCCGAGGTACTGAGCAATACTCAGGG
GGTTGGTTTGGCCATATGATGCCAAATTCCCACATGGATGATACACAGCCACGCCTGATC
AAGCCTAAACCTCTGGTTGTTGCCCATGGTGATGTTCAGAAAGCTAAAGGTGCTTCATGC
AAACTATTTGGAATTCACCTTGACAGCCCAGCGAAATCTGAACCTTTGAAATCTCCATCA
AGTGTTGTATATGATGGGACGCCACAAACACCAGGTGCTACTGAATGGCGCCGACCAGAT
GTAACTGAAGTAGAGAAATGTTCTGATCCTTCTAAGGCCATGAAGCCACTTGATACTCCG
CAACCAGACTCTGTTCCTGAGAAGCCTTCTTCTCAGCAAGCTTCACGAAACATGTCGTGC
AAATCACAAGGTGTATCAACTAGAAGCTGCAAGAAGGTCCACAAGCAAGGCATTGCACTT
GGCAGGTCTGTGGACCTTACAAAGTTTAATGGCTATGAAGAGTTGATTGCTGAGCTGGAT
GACATGTTTGATTTCAATGGTGAACTGAAGGGTCCTAAGAAGGAGTGGATGGTTGTCTAC
ACTGACAACGAAGGTGACATGATGCTAGTTGGGGATGATCCCTGGATTGAATTCTGCGAC
ATGGTTCACAAGATCTTCATCTACACAAGAGAAGAGGTTCAGCGGATGAATCCGGGAACC
CTGAACTCAAGATCAGAAGATAGTCATGCTAATTCAATGGAAAGGGGCTCAGTCGGCAGA
GAAATGCGAGGCTGCTTGTCAACCTCGTCTCTTAATTCTGAGAACTGCTAA

CDS

2511 bp

>Os11t0523800-02 Auxin response factor 1, Transcription factor, Essential for growth in vegetative organs and seed development
ATGGCGACGGCGGAGGTCGGCGGCGGCGGCGGAGGAGGAGGAGGAGGAGGGGAGGACGCG
CTGTTCACGGAGCTGTGGAGCGCGTGCGCGGGGCCGCTGGTGACGGTGCCGAGGGTTGGG
GAGAAGGTGTTCTACTTCCCGCAGGGGCACATCGAGCAGGTGGAGGCCTCGACCAACCAG
GTAGGCGAGCAGCGGATGCAGTTGTACAATCTCCCATGGAAGATCCTGTGTGAGGTTATG
AACGTTGAGCTGAAGGCCGAGCCAGACACCGACGAGGTTTATGCTCAGCTCACTCTGCTT
CCTGAATCGAAGCAACAAGAAGATAACGGCTCTACTGAGGAGGAGGTGCCTTCTGCTCCA
GCAGCTGGGCATGTTAGGCCACGGGTGCACTCATTCTGCAAGACATTGACCGCCTCGGAC
ACGAGCACACATGGCGGCTTCTCGGTGCTGCGACGCCACGCGGACGAATGCCTCCCACCA
CTGGATATGAGCCGTCAGCCTCCAACACAAGAGCTGGTGGCCAAGGATCTGCACGGTGTG
GAATGGCGCTTTCGTCACATATTCAGAGGTCAACCACGAAGACACCTTTTGCAGAGTGGC
TGGAGTGTGTTTGTTAGTGCCAAACGGCTTGTTGCTGGGGATGCCTTTATCTTTCTCAGA
GGTGAGAACGGGGAACTGCGTGTTGGAGTCAGGCGTGCAATGAGGCAGCAAACTAATGTT
CCATCTTCAGTGATATCAAGCCACAGCATGCATCTTGGGGTTCTTGCCACAGCATGGCAT
GCTGTTAACACAGGGACCATGTTCACTGTCTACTACAAGCCTAGGACAAGTCCAGCCGAG
TTTGTGGTCCCTTACGATCGCTATATGGAATCACTGAAACAAAATTACTCCATTGGGATG
AGATTTAAGATGAGGTTTGAAGGTGAAGAGGCTCCAGAGCAAAGATTCACTGGGACTATT
GTCGGAATGGGGGATTCTGATCCAGCTGGCTGGCCTGAATCAAAATGGCGCTCCCTTAAG
GTGAGATGGGATGAAGCTTCTTCCATACCTCGCCCTGAAAGAGTTTCTCCCTGGCAAATA
GAACCTGCTGTAAGCCCTCCTCCTGTCAACCCACTACCAGTTCCAAGAACCAAGAGGCTT
CGTCCGAATGCTACCGCTTTGCCGGCTGACTCTTCTGCTATAGCAAAAGAAGCTGCTACG
AAAGTTGTGGTCGAGTCTGAACCAAATGGTACGCAAAGGACCTTCCAGACACAAGAGAAT
GCAACCCCAAAAAGTGGTTTCGGCAATAGCAGCGAGTTAGAAAGTGCTCAGAAATCAATC
ATGCGTCCATCTGGATTTGATCGTGAGAAAAATAACACTCCCATACAGTGGAAGCTAGGT
TCAGATGGTCGGATGCAGATGAGCAAGCCTGAGAGTTACAGTGAGATGCTATCTGGATTT
CAGCCACCTAAAGATGTACAAATCCCACAGGGTTTCTGTTCTTTACCTGAGCAGATTACT
GCAGGCCATTCTAACTTCTGGCACACAGTAAATGCTCAGTATCAAGATCAACAGAGCAAT
CACAATATGTTCCCCAGCTCATGGTCCTTCATGCCTCCAAATACTCGCCTTGGATTAAAC
AAACAGAACTATTCAATGATTCAGGAAGCTGGTGTGTTGTCTCAAAGGCCTGGAAATACA
AAGTTTGGGAATGGAGTTTATGCTGCACTGCCAGGCCGAGGTACTGAGCAATACTCAGGG
GGTTGGTTTGGCCATATGATGCCAAATTCCCACATGGATGATACACAGCCACGCCTGATC
AAGCCTAAACCTCTGGTTGTTGCCCATGGTGATGTTCAGAAAGCTAAAGGTGCTTCATGC
AAACTATTTGGAATTCACCTTGACAGCCCAGCGAAATCTGAACCTTTGAAATCTCCATCA
AGTGTTGTATATGATGGGACGCCACAAACACCAGGTGCTACTGAATGGCGCCGACCAGAT
GTAACTGAAGTAGAGAAATGTTCTGATCCTTCTAAGGCCATGAAGCCACTTGATACTCCG
CAACCAGACTCTGTTCCTGAGAAGCCTTCTTCTCAGCAAGCTTCACGAAACATGTCGTGC
AAATCACAAGGTGTATCAACTAGAAGCTGCAAGAAGGTCCACAAGCAAGGCATTGCACTT
GGCAGGTCTGTGGACCTTACAAAGTTTAATGGCTATGAAGAGTTGATTGCTGAGCTGGAT
GACATGTTTGATTTCAATGGTGAACTGAAGGGTCCTAAGAAGGAGTGGATGGTTGTCTAC
ACTGACAACGAAGGTGACATGATGCTAGTTGGGGATGATCCCTGGATTGAATTCTGCGAC
ATGGTTCACAAGATCTTCATCTACACAAGAGAAGAGGTTCAGCGGATGAATCCGGGAACC
CTGAACTCAAGATCAGAAGATAGTCATGCTAATTCAATGGAAAGGGGCTCAGTCGGCAGA
GAAATGCGAGGCTGCTTGTCAACCTCGTCTCTTAATTCTGAGAACTGCTAA

Protein

837 aa

>Os11t0523800-02 Auxin response factor 1, Transcription factor, Essential for growth in vegetative organs and seed development
MATAEVGGGGGGGGGGGEDALFTELWSACAGPLVTVPRVGEKVFYFPQGHIEQVEASTNQ
VGEQRMQLYNLPWKILCEVMNVELKAEPDTDEVYAQLTLLPESKQQEDNGSTEEEVPSAP
AAGHVRPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPTQELVAKDLHGV
EWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGENGELRVGVRRAMRQQTNV
PSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRTSPAEFVVPYDRYMESLKQNYSIGM
RFKMRFEGEEAPEQRFTGTIVGMGDSDPAGWPESKWRSLKVRWDEASSIPRPERVSPWQI
EPAVSPPPVNPLPVPRTKRLRPNATALPADSSAIAKEAATKVVVESEPNGTQRTFQTQEN
ATPKSGFGNSSELESAQKSIMRPSGFDREKNNTPIQWKLGSDGRMQMSKPESYSEMLSGF
QPPKDVQIPQGFCSLPEQITAGHSNFWHTVNAQYQDQQSNHNMFPSSWSFMPPNTRLGLN
KQNYSMIQEAGVLSQRPGNTKFGNGVYAALPGRGTEQYSGGWFGHMMPNSHMDDTQPRLI
KPKPLVVAHGDVQKAKGASCKLFGIHLDSPAKSEPLKSPSSVVYDGTPQTPGATEWRRPD
VTEVEKCSDPSKAMKPLDTPQPDSVPEKPSSQQASRNMSCKSQGVSTRSCKKVHKQGIAL
GRSVDLTKFNGYEELIAELDDMFDFNGELKGPKKEWMVVYTDNEGDMMLVGDDPWIEFCD
MVHKIFIYTREEVQRMNPGTLNSRSEDSHANSMERGSVGREMRGCLSTSSLNSENC*

CDS

chr11:18941423..18941453 (- strand) : 31 bp

chr11:18941146..18941273 (- strand) : 128 bp

chr11:18940213..18940308 (- strand) : 96 bp

chr11:18940074..18940130 (- strand) : 57 bp

chr11:18939796..18939966 (- strand) : 171 bp

chr11:18939596..18939680 (- strand) : 85 bp

chr11:18938971..18939061 (- strand) : 91 bp

chr11:18938718..18938882 (- strand) : 165 bp

chr11:18938421..18938540 (- strand) : 120 bp

chr11:18938255..18938330 (- strand) : 76 bp

chr11:18938006..18938177 (- strand) : 172 bp

chr11:18936984..18937927 (- strand) : 944 bp

chr11:18936242..18936432 (- strand) : 191 bp

chr11:18935967..18936150 (- strand) : 184 bp

FASTA

>Os11t0523800-02 class=Sequence position=chr11:18935967..18941453 (- strand)
ATGGCGACGG CGGAGGTCGG CGGCGGCGGC GGTGAGGGGG ATGCTGCTGC CGCGGCGGTG GCGCGAGGTG AGCTCCTCTC
GGTGGTGGGT GGGCGTGTGT GGGTTTGCGC GTGGGTTTTT TGTGGGCTGG CTTGTGATGC CGGCTTTTGG GCTTTGGGCT
TGCAGCAGGC GGCGGCGGCG GAGGAGGAGG AGGAGGAGGG GAGGACGCGC TGTTCACGGA GCTGTGGAGC GCGTGCGCGG
GGCCGCTGGT GACGGTGCCG AGGGTTGGGG AGAAGGTGTT CTACTTCCCG CAGGGGCACA TCGAGCAGGT GAGTCCGAGT
CCGAGCTCGA GGTCGAGCAG AGCGCGCGCC GCCCAATTCG GGCGCGGGGT GGTGGCGGTG GCGGCGGCCG CCTTTCTCGC
CTCTCCGCGA TTCCCCGCTT TTTATTAGAG AGTTTATTAG TTCCATTTCG ATTTCTCTTC CTGGTCCTTT TCCGCCGTTT
GATTTTGAGA GTTTTTTTGG TTTTCAACTC TCTTTTCTCT CTCTTCGTGT TTCTGTTGAT CCGAGTGGCG TCTTCGGGTT
TGAGCTGTTT TGAAGCCACT CGTTTTTTTT CTTCTTGACT TGTTCAAATG CTTGAGGTTT TGGTGTTTAT GCGTCCTAGC
GGCGATGGGA ATCTTTTAAG ATAAATTTTG GGGGGAATTT GTCTGTGCCG TTGGCGAATT TCGCTTTCTT GAGTTTGTGT
CGTGGAATTT TGGCGGGTTT TGAGCATTTT TGGTGATGCG GTTTTGGGGT TTACGTTTTG CCTCTCTAAA ATTCGAAGTT
TTTTCCAAGT TTTTTCGGTT ATACTGTATG CAATTCTCTG GTTCGAACTA AGTTTCCGAG TTGTCGCAGT TGCTGAGTGT
GAGATTGGAA CTATTTGAAT GGGGAATTCT GTAGTTTTTG TGCCGGATCG CTTCGCCTAT GAGTCGAATT CGGCTTCTTG
GTTGCCAAAA TTCGGAATTC TGTGTTTTAC TTCGCAAAAG AAAAAAAAAC TGGGGATTTT CGTGCTTGGT ACTGAACTAG
TGATAATTTG TTCTTCCTGC ATTCTTGCAA ATGTATTTTT TTTCTTGGCT GGAATCAGTG TTTCGGTGGC TGATTTTGGA
ATTCTTTGCC TCTGTCCATT TTCAGGTGGA GGCCTCGACC AACCAGGTAG GCGAGCAGCG GATGCAGTTG TACAATCTCC
CATGGAAGAT CCTGTGTGAG GTTATGAACG TTGAGCTGAA GGTACTTGCT TTGTGTTTCT TGTGAATTCT GAGAGCTTTC
ATTCTTGGTT GTATGTGTGG TTGACATATA GCTCTGTTTG TAGGCCGAGC CAGACACCGA CGAGGTTTAT GCTCAGCTCA
CTCTGCTTCC TGAATCGAAG GTAAAAAAAA AAATGTCTCC AGTTTGCACG CTGTCACTGC TTCATACATT CCGGGATAGA
AGTTTTGAGC GTTTTGAAAG GAAAAAAAAT GTTGGTCTGT TGTGTAGCAA CAAGAAGATA ACGGCTCTAC TGAGGAGGAG
GTGCCTTCTG CTCCAGCAGC TGGGCATGTT AGGCCACGGG TGCACTCATT CTGCAAGACA TTGACCGCCT CGGACACGAG
CACACATGGC GGCTTCTCGG TGCTGCGACG CCACGCGGAC GAATGCCTCC CACCACTGGT TCGTCCCACT GGTTCTTTGA
CTTGATGTTG TTTTCAGTGA TGTACTTGTA GTCCTAGGTC TTACTAGGAT GCTTGAGTTG TAGTGATGAT CTTTGCTTTG
GCTTCTTGAT CAGGATATGA GCCGTCAGCC TCCAACACAA GAGCTGGTGG CCAAGGATCT GCACGGTGTG GAATGGCGCT
TTCGTCACAT ATTCAGAGGT GATCACTCTT CCAACATCGT ACTTATTTCT CTATTTTCTG AAGGACGTGT GATGCTCACT
GCTCTTTGCT AATGAACACA AGTTTCCATG ATATCATGAC TAGGAGACAT CTTTACACTG CTCTTGGGTT GATCGTATAG
TGTAAGAACA GTTCTTGCAT TTGACTAACC CCTTCATTTA TAATATTGGT ATTAAATGCA CTTTTTTGGT ACGATGCCTA
TCCCGTATTA TCTTGATGGC TTTATTAGAG GGACCAGTTT GTGCTTCCCA CAATTTCTTG TGCATTTTTG TTCTTTGCAT
GGGCCTACAC TTGATGGAGT ATGGATAACT ACAACTTTTG TTGGTTGATG CTGCAGTGGT CGTGCTCTAG TTTCTTAGGA
CAAGTAGTTT ATGCTTTCAT ATGCCCTTGT GATGTAAGAG TTGTGCTAAT TGATTATGTT GTCCTGCCCG AGTTTCGATT
GCACCTAGGT TAGAAGGAAG TTAATTTTTT GCTTCAACTC TTCTTGAGCT ATATCTTTTT GATCAACATC AGGTCAACCA
CGAAGACACC TTTTGCAGAG TGGCTGGAGT GTGTTTGTTA GTGCCAAACG GCTTGTTGCT GGGGATGCCT TTATCTTTCT
CAGGTTTGAT AATTTGACAC AGTGTTTGCT TTGTCTACCT GTGCTTTCCC CTGTACTGCT TAATAAATAT CCCCCTATAT
GATCTGCACA GAGGTGAGAA CGGGGAACTG CGTGTTGGAG TCAGGCGTGC AATGAGGCAG CAAACTAATG TTCCATCTTC
AGTGATATCA AGCCACAGCA TGCATCTTGG GGTTCTTGCC ACAGCATGGC ATGCTGTTAA CACAGGGACC ATGTTCACTG
TCTACTACAA GCCTAGGTTT GTTGTGAAGT TTTTCTGGAT TTTATGCACA TGATTTTATT TATGCACTTT GGGAGCATTG
TCTGTTTACT TGTCACCTGA ATTCTGAACT GATCTTGCTA TGTGATAGAA TTAAATTTGT CCGATTGTGC TAGCACTTAA
ACGCTATCGC TGAAATCTTC TATTTTTCAT CAGGACAAGT CCAGCCGAGT TTGTGGTCCC TTACGATCGC TATATGGAAT
CACTGAAACA AAATTACTCC ATTGGGATGA GATTTAAGAT GAGGTTTGAA GGTGAAGAGG CTCCAGAGCA AAGGTAGCAC
TTAGATGGAT ATGCATTCTA CTTTTGACAG GTGATTCCTC TGTATCTGAA TCAACCGATT AATCTTTAAT GCTCATGCAT
TAGATTCACT GGGACTATTG TCGGAATGGG GGATTCTGAT CCAGCTGGCT GGCCTGAATC AAAATGGCGC TCCCTTAAGG
TTTATTTCTT TCGCCACTTT CCATTTAAAT AACATTTATT TTCTGAGAAT TTCTTACAGA TTTTTGTGTT ACTTAGGTGA
GATGGGATGA AGCTTCTTCC ATACCTCGCC CTGAAAGAGT TTCTCCCTGG CAAATAGAAC CTGCTGTAAG CCCTCCTCCT
GTCAACCCAC TACCAGTTCC AAGAACCAAG AGGCTTCGTC CGAATGCTAC CGCTTTGCCG GCTGACTCTT CTGCTATAGC
AAAAGAAGGT CAGACCTTGT CATCAATATG AAATCTACAG TATAGCTTCG TTGTCTTTAC TAATGCACGT CTTTTCTTCA
ATCTAGCTGC TACGAAAGTT GTGGTCGAGT CTGAACCAAA TGGTACGCAA AGGACCTTCC AGACACAAGA GAATGCAACC
CCAAAAAGTG GTTTCGGCAA TAGCAGCGAG TTAGAAAGTG CTCAGAAATC AATCATGCGT CCATCTGGAT TTGATCGTGA
GAAAAATAAC ACTCCCATAC AGTGGAAGCT AGGTTCAGAT GGTCGGATGC AGATGAGCAA GCCTGAGAGT TACAGTGAGA
TGCTATCTGG ATTTCAGCCA CCTAAAGATG TACAAATCCC ACAGGGTTTC TGTTCTTTAC CTGAGCAGAT TACTGCAGGC
CATTCTAACT TCTGGCACAC AGTAAATGCT CAGTATCAAG ATCAACAGAG CAATCACAAT ATGTTCCCCA GCTCATGGTC
CTTCATGCCT CCAAATACTC GCCTTGGATT AAACAAACAG AACTATTCAA TGATTCAGGA AGCTGGTGTG TTGTCTCAAA
GGCCTGGAAA TACAAAGTTT GGGAATGGAG TTTATGCTGC ACTGCCAGGC CGAGGTACTG AGCAATACTC AGGGGGTTGG
TTTGGCCATA TGATGCCAAA TTCCCACATG GATGATACAC AGCCACGCCT GATCAAGCCT AAACCTCTGG TTGTTGCCCA
TGGTGATGTT CAGAAAGCTA AAGGTGCTTC ATGCAAACTA TTTGGAATTC ACCTTGACAG CCCAGCGAAA TCTGAACCTT
TGAAATCTCC ATCAAGTGTT GTATATGATG GGACGCCACA AACACCAGGT GCTACTGAAT GGCGCCGACC AGATGTAACT
GAAGTAGAGA AATGTTCTGA TCCTTCTAAG GCCATGAAGC CACTTGATAC TCCGCAACCA GACTCTGTTC CTGAGAAGCC
TTCTTCTCAG CAAGCTTCAC GAAACATGTC GTGCAAATCA CAAGGTGTAT CAACTAGAAG CTGCAAGAAG GTACCACTTT
CTTGTTATTA TTGCACTTAT CACCTCTTTG CAATCTCCAA GTTCTTCCTT GTGAATGATT TTAAATAATT CTCCAACAAG
TTTTCCTCCC CTCCTAGATA TGCCCAATAA GATTAATTTT GGAGCACCTT TGGATAtact tcctccgttt catattataa
gactttctag cattgcccac attcatatat atatatatgt taataaatct agacatatat gtgtgcctat attctttaac
atctatatga atgtaggcaa tgctagaaag tcttataacc tgaaacggag gtagtaTTAT ATTTCAAAGG TCCAAATGTA
CAAACTTGCT CAGTATTTTT TTTTGCCAAA GTTAATATAG CTCAACTCAT TCTCTAATCT CTCCTATAGA TGCATAATCA
AACCCTTGTT TCTTACATAT AATCTTTCCT TCGGAAGCAT GTTTGGCACT ACTTATACCA TCCTCAAGTG CTCAGCTTAA
TTATTTTTTC TAGATTTTCC CTGTTTTCCA ACATGATGGT TGATAAACTA TACATTTCCA GGTCCACAAG CAAGGCATTG
CACTTGGCAG GTCTGTGGAC CTTACAAAGT TTAATGGCTA TGAAGAGTTG ATTGCTGAGC TGGATGACAT GTTTGATTTC
AATGGTGAAC TGAAGGGTCC TAAGAAGGAG TGGATGGTTG TCTACACTGA CAACGAAGGT GACATGATGC TAGTTGGGGA
TGATCCCTGG ATGTGAGTTA ACTCATAAAT GCTTTCCTCA TTCGCTGATC TGATTTAATG ACATCACAAA TGCTGACTGC
ATCGGACAAT CATTCTTGAA CAGTGAATTC TGCGACATGG TTCACAAGAT CTTCATCTAC ACAAGAGAAG AGGTTCAGCG
GATGAATCCG GGAACCCTGA ACTCAAGATC AGAAGATAGT CATGCTAATT CAATGGAAAG GGGCTCAGTC GGCAGAGAAA
TGCGAGGCTG CTTGTCAACC TCGTCTCTTA ATTCTGAGAA CTGCTAA

Locus: Os11g0523800

Loading...

Locus: Os11g0523800

Loading...