Os11t0528700-01

Locus

Os11g0528700

Description

Indole-3-acetic acid (IAA)-amido synthetase, Plant architecture establishment, Drought tolerance

RAP-DB Gene Symbol Synonym(s)

GH3-13, OsGH3-13, TLD1/OsGH3.13, TLD1, OsGH3.13, TLD2

RAP-DB Gene Name Synonym(s)

GH3-13, increased number of tillers, enlarged leaf angles, and dwarfism 1

CGSNL Gene Symbol

TLD1

CGSNL Gene Name

INCREASED NUMBER OF TILLERS, ENLARGED LEAF ANGLES AND DWARFISM 1

Oryzabase Gene Symbol Synonym(s)

OsGH3-13, GH3-13, TLD1/OsGH3.13, TLD1, OsGH3.13, TLD2

Oryzabase Gene Name Synonym(s)

increased number of tillers, enlarged leaf angles, and dwarfism 1

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 19776160

Note

Manual Curation

January 21, 2010

Functional domain (InterPro)

GH3 auxin-responsive promoter (IPR004993)

Expression Databases

TENOR (Os11t0528700-00)

Others

Oryzabase (11630)

Transcript

1989 bp

>Os11t0528700-01 Indole-3-acetic acid (IAA)-amido synthetase, Plant architecture establishment, Drought tolerance
ATGACGTCCACGTCGTCTGAAAATgcgcccgaccacgaccacgaccacgacgcctcttcg
ccggcgccggcgacggcgacggcggcggcgctgccaccgatgatcccggcgtgcgacccg
cacgacgggccggcgtgcctggagctcatcgaggtgctgaccacgcgcgccgccgccgtc
cagcggcgcgtcctcgccgaggtcctcgccatgaacaccggcaccgactacctccgccgg
TTTCTCGGCGACGAGGTCGTCGCCGCCGCCGGCGGCGAGGACGAGCTCGCCGCGGCGTTC
AAGGAGCGCGTGCCGGTGGTGGAGTACGAGGACGTGAAGCCGTACATCGAGCGCATCGCC
AACGGCGCCCCGTCGTCGCTCATCTCCTCCAAGCCCATCACCGAGCTCCTCACGAGCTCC
GGCACGTCAGGCGGGCAGCCGAAGCTGATGCCGGCGACGGAGGAGGAGCTCGACCGCAAG
ACCTTCCTCTACAACCTCCTCGTCCCCGTCATGAACAAGTACGTGGAGGGGCTGGACGAG
GGGAGGGGGATGTACCTGCTGTTCGTGAAGCCGGAGATCACGACGGCGTCGGGGATGGTG
GCGAGGCCGGTGCTGACGAGCTACTACAAGAGCCGCCACTTCCGGCGGCGGCCGGACAGC
CCGTACACGCGGTACACGAGCCCCGACGCGGCGATCCTCTGCCCGGACAGCCGCCAGAGC
ATGTACGCGCAGCTGCTCTGCGGCctcgcccgccgcggcgaggtgctccgcgtcggcgcc
gtcttcgcctccgccttcctccgcgccgtcaagttcctcgagggccactggcgcgccctc
tgcgccgacatccgcgccggccgcgccgacccggccgtcgtcaccgacgccgcctgccgc
ggcgccgtcgacgccgtcctcgccgcccgcgccgaccccgacctcgccgACGCCATCGCC
GCCGAGTGTGGCGGCGCGTCGTGGCGGGGCATCGTGCGGCGGCTGTGGCCGCGGACCAAG
TACATCGACGTGATCGTGACGGGGTCCATGGCGCAGTACATCCCGCTGCTGGAGTTCTAC
GGCGGCGGGCTGCCGCTGGTGTCGACGATGTACGCGTCGTCGGAGTCCTACTTCGGCATC
AACCTCCGGCCGCTGGACCCGCCGGAGGAGGTGGTGTACACGCTGCTGCCCAACATGTGC
TACTACGAGTTCATCAAGGTGGAGAAGGACGGCGACGGCGAGAAGGTCCGCGACGGCGAG
GTGGTGGACCTCGTCGGCGTCGAGGTCGGCGCCTACTACGAGCTCGTCGTCACCACCTTC
ACAGGGTTGTACCGGTACAGGGTGGGGGACATCCTGCAGGTGGCCGGGTTTCACAACGCG
GCGCCGCAATTCCGGTTCGTGCACCGGCGCAACGTCGTCCTCAGCGTCGACACCGACAAG
ACCTCCGAGGACGACCTCCTCCGCGCCGTCACCGCTGCGAAGCCCCTCCTCGACCCCCTC
TCCTGCGTCCTCGCGGAGTACACCGCCTACGCCGACACCTCCTCCATCCCCGGCCACTAC
GTCCTCTTCTGGGAGCTCACCCCCTCTCCCTCGCCACCGCCGCCGCCATGCCATGACGAC
GCCGACGACGCAGCCGACATCGGCGAGGACAAGGACAAGGTGGCACACGTCATGGCGGCG
TGCTGCGCCGCCGTGGAGGCCGGGCTGGACTCGGTGTACCGGCGGTGCAGGAGCCGGGAC
AGGTCGATCGGGCCGCTGGAGATCCGTGTCGTGGCGCCGGGGGCGTTCGACGCGCTCATG
GACATGTGCGTGTCGCACGGCTCGTCGGTGAACCAGTACAAGACGCCGCGGTGCATCAAG
CACCCCGACGCCATCGCCGTCCTCGAGCAGCGCGTCGTCGGCCGCTTCTTCAGCGACGCC
GTCCCGCACTGGGAGCCCCTCAAGGTCGACGGCGCCGCCGCCGCCCCCGCCACCGGCAGC
GACCAGTGA

CDS

1989 bp

>Os11t0528700-01 Indole-3-acetic acid (IAA)-amido synthetase, Plant architecture establishment, Drought tolerance
ATGACGTCCACGTCGTCTGAAAATgcgcccgaccacgaccacgaccacgacgcctcttcg
ccggcgccggcgacggcgacggcggcggcgctgccaccgatgatcccggcgtgcgacccg
cacgacgggccggcgtgcctggagctcatcgaggtgctgaccacgcgcgccgccgccgtc
cagcggcgcgtcctcgccgaggtcctcgccatgaacaccggcaccgactacctccgccgg
TTTCTCGGCGACGAGGTCGTCGCCGCCGCCGGCGGCGAGGACGAGCTCGCCGCGGCGTTC
AAGGAGCGCGTGCCGGTGGTGGAGTACGAGGACGTGAAGCCGTACATCGAGCGCATCGCC
AACGGCGCCCCGTCGTCGCTCATCTCCTCCAAGCCCATCACCGAGCTCCTCACGAGCTCC
GGCACGTCAGGCGGGCAGCCGAAGCTGATGCCGGCGACGGAGGAGGAGCTCGACCGCAAG
ACCTTCCTCTACAACCTCCTCGTCCCCGTCATGAACAAGTACGTGGAGGGGCTGGACGAG
GGGAGGGGGATGTACCTGCTGTTCGTGAAGCCGGAGATCACGACGGCGTCGGGGATGGTG
GCGAGGCCGGTGCTGACGAGCTACTACAAGAGCCGCCACTTCCGGCGGCGGCCGGACAGC
CCGTACACGCGGTACACGAGCCCCGACGCGGCGATCCTCTGCCCGGACAGCCGCCAGAGC
ATGTACGCGCAGCTGCTCTGCGGCctcgcccgccgcggcgaggtgctccgcgtcggcgcc
gtcttcgcctccgccttcctccgcgccgtcaagttcctcgagggccactggcgcgccctc
tgcgccgacatccgcgccggccgcgccgacccggccgtcgtcaccgacgccgcctgccgc
ggcgccgtcgacgccgtcctcgccgcccgcgccgaccccgacctcgccgACGCCATCGCC
GCCGAGTGTGGCGGCGCGTCGTGGCGGGGCATCGTGCGGCGGCTGTGGCCGCGGACCAAG
TACATCGACGTGATCGTGACGGGGTCCATGGCGCAGTACATCCCGCTGCTGGAGTTCTAC
GGCGGCGGGCTGCCGCTGGTGTCGACGATGTACGCGTCGTCGGAGTCCTACTTCGGCATC
AACCTCCGGCCGCTGGACCCGCCGGAGGAGGTGGTGTACACGCTGCTGCCCAACATGTGC
TACTACGAGTTCATCAAGGTGGAGAAGGACGGCGACGGCGAGAAGGTCCGCGACGGCGAG
GTGGTGGACCTCGTCGGCGTCGAGGTCGGCGCCTACTACGAGCTCGTCGTCACCACCTTC
ACAGGGTTGTACCGGTACAGGGTGGGGGACATCCTGCAGGTGGCCGGGTTTCACAACGCG
GCGCCGCAATTCCGGTTCGTGCACCGGCGCAACGTCGTCCTCAGCGTCGACACCGACAAG
ACCTCCGAGGACGACCTCCTCCGCGCCGTCACCGCTGCGAAGCCCCTCCTCGACCCCCTC
TCCTGCGTCCTCGCGGAGTACACCGCCTACGCCGACACCTCCTCCATCCCCGGCCACTAC
GTCCTCTTCTGGGAGCTCACCCCCTCTCCCTCGCCACCGCCGCCGCCATGCCATGACGAC
GCCGACGACGCAGCCGACATCGGCGAGGACAAGGACAAGGTGGCACACGTCATGGCGGCG
TGCTGCGCCGCCGTGGAGGCCGGGCTGGACTCGGTGTACCGGCGGTGCAGGAGCCGGGAC
AGGTCGATCGGGCCGCTGGAGATCCGTGTCGTGGCGCCGGGGGCGTTCGACGCGCTCATG
GACATGTGCGTGTCGCACGGCTCGTCGGTGAACCAGTACAAGACGCCGCGGTGCATCAAG
CACCCCGACGCCATCGCCGTCCTCGAGCAGCGCGTCGTCGGCCGCTTCTTCAGCGACGCC
GTCCCGCACTGGGAGCCCCTCAAGGTCGACGGCGCCGCCGCCGCCCCCGCCACCGGCAGC
GACCAGTGA

Protein

663 aa

>Os11t0528700-01 Indole-3-acetic acid (IAA)-amido synthetase, Plant architecture establishment, Drought tolerance
MTSTSSENAPDHDHDHDASSPAPATATAAALPPMIPACDPHDGPACLELIEVLTTRAAAV
QRRVLAEVLAMNTGTDYLRRFLGDEVVAAAGGEDELAAAFKERVPVVEYEDVKPYIERIA
NGAPSSLISSKPITELLTSSGTSGGQPKLMPATEEELDRKTFLYNLLVPVMNKYVEGLDE
GRGMYLLFVKPEITTASGMVARPVLTSYYKSRHFRRRPDSPYTRYTSPDAAILCPDSRQS
MYAQLLCGLARRGEVLRVGAVFASAFLRAVKFLEGHWRALCADIRAGRADPAVVTDAACR
GAVDAVLAARADPDLADAIAAECGGASWRGIVRRLWPRTKYIDVIVTGSMAQYIPLLEFY
GGGLPLVSTMYASSESYFGINLRPLDPPEEVVYTLLPNMCYYEFIKVEKDGDGEKVRDGE
VVDLVGVEVGAYYELVVTTFTGLYRYRVGDILQVAGFHNAAPQFRFVHRRNVVLSVDTDK
TSEDDLLRAVTAAKPLLDPLSCVLAEYTAYADTSSIPGHYVLFWELTPSPSPPPPPCHDD
ADDAADIGEDKDKVAHVMAACCAAVEAGLDSVYRRCRSRDRSIGPLEIRVVAPGAFDALM
DMCVSHGSSVNQYKTPRCIKHPDAIAVLEQRVVGRFFSDAVPHWEPLKVDGAAAAPATGS
DQ*

CDS

chr11:19189710..19190125 (- strand) : 416 bp

chr11:19189516..19189617 (- strand) : 102 bp

chr11:19188651..19189456 (- strand) : 806 bp

chr11:19184337..19185001 (- strand) : 665 bp

FASTA

>Os11t0528700-01 class=Sequence position=chr11:19184337..19190125 (- strand)
ATGACGTCCA CGTCGTCTGA AAATgcgccc gaccacgacc acgaccacga cgcctcttcg ccggcgccgg cgacggcgac
ggcggcggcg ctgccaccga tgatcccggc gtgcgacccg cacgacgggc cggcgtgcct ggagctcatc gaggtgctga
ccacgcgcgc cgccgccgtc cagcggcgcg tcctcgccga ggtcctcgcc atgaacaccg gcaccgacta cctccgccgg
TTTCTCGGCG ACGAGGTCGT CGCCGCCGCC GGCGGCGAGG ACGAGCTCGC CGCGGCGTTC AAGGAGCGCG TGCCGGTGGT
GGAGTACGAG GACGTGAAGC CGTACATCGA GCGCATCGCC AACGGCGCCC CGTCGTCGCT CATCTCCTCC AAGCCCATCA
CCGAGCTCCT CACGAGGTAA GCTCAAGCTC GATCGATCTC GATCTCGCCA TGGCTAACCT CACAATTTGA CACAATCACT
CGGTCGATCA TGGCGATGTG CGCCGCAGCT CCGGCACGTC AGGCGGGCAG CCGAAGCTGA TGCCGGCGAC GGAGGAGGAG
CTCGACCGCA AGACCTTCCT CTACAACCTC CTCGTCCCCG TCATGAACAA GTGAGTCTCT CTCGCTGGCT TCGCCATCGA
TCGCCATGGA TGCTGACATG GAGGTGCAGG TACGTGGAGG GGCTGGACGA GGGGAGGGGG ATGTACCTGC TGTTCGTGAA
GCCGGAGATC ACGACGGCGT CGGGGATGGT GGCGAGGCCG GTGCTGACGA GCTACTACAA GAGCCGCCAC TTCCGGCGGC
GGCCGGACAG CCCGTACACG CGGTACACGA GCCCCGACGC GGCGATCCTC TGCCCGGACA GCCGCCAGAG CATGTACGCG
CAGCTGCTCT GCGGCctcgc ccgccgcggc gaggtgctcc gcgtcggcgc cgtcttcgcc tccgccttcc tccgcgccgt
caagttcctc gagggccact ggcgcgccct ctgcgccgac atccgcgccg gccgcgccga cccggccgtc gtcaccgacg
ccgcctgccg cggcgccgtc gacgccgtcc tcgccgcccg cgccgacccc gacctcgccg ACGCCATCGC CGCCGAGTGT
GGCGGCGCGT CGTGGCGGGG CATCGTGCGG CGGCTGTGGC CGCGGACCAA GTACATCGAC GTGATCGTGA CGGGGTCCAT
GGCGCAGTAC ATCCCGCTGC TGGAGTTCTA CGGCGGCGGG CTGCCGCTGG TGTCGACGAT GTACGCGTCG TCGGAGTCCT
ACTTCGGCAT CAACCTCCGG CCGCTGGACC CGCCGGAGGA GGTGGTGTAC ACGCTGCTGC CCAACATGTG CTACTACGAG
TTCATCAAGG TGGAGAAGGA CGGCGACGGC GAGAAGGTCC GCGACGGCGA GGTGGTGGAC CTCGTCGGCG TCGAGGTCGG
CGCCTACTAC GAGCTCGTCG TCACCACCTT CACAGGTGAG CGCGTGTGCA GCCCGTTCGA TTTCTTTCCC ACCTCCTGCA
TGGGTTTATC AACGCCGTCC GATCGCAAAA TCAACGGCTG AGATTGGTTG AGCCCGTCTC ACGTTAATAC TACCTCCATG
GTATGACGcc aacatttaac catttaactt atttaaaaaa gtatataaaa tgttatttat tttgttgtga cttgtttcaa
caaaggaacc ataatattaa gatatatttt taaatattta tttatattat ttttttaata aacgaagtca aacgctatgg
aaaagtctaa cagcgtcatg cgtaaaaaca gaggtaataT TATTTTTCCA AGTACTGTTC CTCGAATTTT CTTTTACCAT
TTTCGGGTGG GTAATTTTAA GTTTAAAGTG AATAAAACAT AAAAATATTA ACATGTAGCA CAGTTACTTA ATTATTGATC
AACTAATTAA CTGTCGCAAA GACGGCACGG AAACTGTAGC AACAATACAC ACAGCATGTA GGAACCATTA TTCAGAAAAT
CATAGCTAAG ATGAAGTGCC CCTATAGGAG AGGATTAGCG ATCCAAATTG GGCAAATCTT ATTTATATCT CCTCGAAATA
GGAGGGGTGA AGTCCCTTTC CCAGAAAAGA AGAAATGAAt tagtgaaaac gtttttctaa tgttccataa tgaagataat
aatcatgcac cttgagaaaa aaaatcatca tgtaagttcc acctttacta agatacgcga attgcaaaat gacatcgtac
atgagaatga catgtaggac ctgttctaca agtcgatgct aaaatgatgg tatttttcag ctccgtgttt tttgcggtgg
cacGTACCAA AACAATAAAA TGAAACTTTT TTGCGATGTG ATACCATTCC TGGCATGCAT TGTGGTCTAT TCGAAAGATA
AGTGCAGGTG TCCTTTAGAC GAAAAGGTTA TGAGTCACCT GTTCTATCTT TTAACTTGTT TAGATTTTTG TTTTGGTTTT
TGTGGTCTCC CTGTTGTTCC TCTAATGGTG GATACAGTCA CACACTAATG AATTCTGCTT CCCTAAGCCA CAGTACACAA
GCTCGATTTT TAGTTTACAA CAGAAGTAAC ATCACACATC TTTTCCCTTG AGGCTAGCTA CTTAATATCT AAAAGAAGGT
TTAATTTAAT TTCATCGAGA AATAAGAGTT ACTAGCAAGT AGTATAAGCT ATAAGCTAAC TGCAAGTCGA TTGGTTGGGG
AGTCAGAGAA TTATTTTCTT AGGTACCATT TTTCAAATTA ATCTAATTAA TCCAAGGCAA TGCATGGGTG TTAACATAAA
ATAGATTTTT ATTAGCTTAC TGTACTTTCC ATTTCTTTTA TATTGAAGGA ATAAGTAAAG AGCACACTTG TTTAGTTGCT
TATGTTTCTT GTGATGAGAT GTGGCAAGAT TAAAATATTG GTAACTTGAT TATTTGAGTA GATTTTTTTC AGAGTTTGAC
CAAATAATTA AGTTATAGCT TGGGATTCCC TACTAGGCCA ACGGGGTATA GTGTGTAGAG TGCTTGACTC CCACTGCATT
ATCTCCTAGC TTGCCTATAG CCTTTCATGT CTGCACTTAA TTATACTTAC TTTAACCCGA CATGGAGACG TTGGTATCAA
CTACTTGCTC CCTCTGTGTA ATATGTATAT AATTTATATA TTGGGTGATG GAAATTATAT ATATCACTAG AATATTTGAA
AAATATCTTG ATAATTAACA TACTATCTAA TTACGAACCA GTAGTTATCA CAAGAAAGGA TGTAGTCACA ATATATAGTT
CATTGCATAC TTAATTATTA AGAGGGGTAA AACAAAAATA GTTGCAGGAA AATTAAAAAA ATATTTGACA ACATAAACAT
TATATATGTA TGATGCTATC TACTACTACA CGAAAAATGG TATTAGCTAA AGAAAAGATA AAAAATGATA CGTCTAGCTT
TTCATTGAGA AAGTTCAGTT GTACAGATCA CTAGAGAAGC TGCATGGTTG ATATATGACA TATACCTCAT TTGATTAATG
CAGTGCGTAG AGTGCTTGAC TTCCACTGCA TTATCTCCTA GCTTGATTAA ATTTACTCAA GGATTCATTA ATTCCACCCA
AATCAAAATG ATATATGTGC ATCATCTGAA AACAATGATA TATTATGCAT GGAAGAATCA ATGATAGATG ACACAAAAAA
AAGTTGATCG AGATGTGACA TATTAAAACA ATATCCGATT TCTTTGACCT TCCTCTCTCA ACCCTGCACT ACCAGCTGAA
TAAATTTATT ATAAATTTGC ATTTCCATAA AAAAAATGGA CTGTGCACAT CATCTGATGG ATCCGCCATA CATAAACTAT
GCTCCTAAAT AAAAGTTGTT TAATGCAATA CTGAATCAAA TAGATAGCAA TTGCACGTGG AAAAGCCCTA CACAAGTGTG
TGACCTGGCA CAAAGTCAAA GTGCCAATTA TTGTAGCATA TGCATGGCCA GTGATGTGTA CCAAAATATT TCAGCAATTT
AATTCAGTAT TAAAATTTAT AAAGTCCTCC GCAAAAAAAA GGCTAGGTAG ATTAAATAGT TGCTAATTAT CTTGAAGCAT
ATTTATTTTA TTTTGAGTAA TAAGAATAAA ATATAGTTAT TACTTCAGTG GGAGAATTTT TTTTTTTGCC AGAACTTAAT
TAAGCAACAC TGAAACTGAC TTCTTGTCAA AGtactacct acatctctca atgtttgacg ttggttaatg caaatttgca
gtaaccaatg ttaaacaaaa aagaacggag ttagtataat TTATGTGCCT CTTTATCTCA GTAAATTTCA CGGATTGAAA
TGTTTATGTA GTTTCATTAT CCCAAAAGAT AGTATGTCAC TTAAAAGAAA TTTAGATAGA AAGGTGTTCT TTTAGAGGGC
CCAGGCTAAA AACACAGAGC CTCTGCACCA AAAAGGACAG GTATCCTCAG TGGGCTGAAA AGGCCGTGCT GGCATTTTCT
TTGGCCCAAC AACTTCTTAC TCCCCTACTT ACATTGTCGG AATACTTAGT ATATTTTGTT TTCCAAGCAT TTTACTAACA
ACTATCACAC TCCTCACATA AAAAAAATCA CTTAAAAAAT GCCACAACAA TCACCTACCA AAAAAAATCA CGTGTTCCAA
AAAAAAAAGG CATATAGGTA CTTAGTTTGT AATGTGAGGC CCATTTTGAA TTTTAATATT TAGCGGATCG CCATCATGGA
TTGTACttac tagggatgaa ttaaatattt tgataaacaa acttaaccaa tagtttagaa caagcagtat aaacaatgca
ttagaaactc tctttttttc tgaggaaaca tactttttaa aggatggagc aaataatGAA AAATGCTATA TAACATACCC
CGTTCGGACA TGATGATACA TCGGAGGTAT CACCTGGGTA TCAGCTGATA CCTACCAGAT ATCAGGTGAT GCCTCTGAGG
TATCATCCTG TTCAAATGGG GTATAAGCGA TACCTGCCAG GTATCAGACG ATACTTCTAG AATATCATCC CTTTAAACGG
AATACCGTAC TATATCATTC CCCCAAATAA TTCGTTTTAA TAATCCAATA ATAAATAATT GGGTTAATAA TTAATTGTGT
GCAGGGTTGT ACCGGTACAG GGTGGGGGAC ATCCTGCAGG TGGCCGGGTT TCACAACGCG GCGCCGCAAT TCCGGTTCGT
GCACCGGCGC AACGTCGTCC TCAGCGTCGA CACCGACAAG ACCTCCGAGG ACGACCTCCT CCGCGCCGTC ACCGCTGCGA
AGCCCCTCCT CGACCCCCTC TCCTGCGTCC TCGCGGAGTA CACCGCCTAC GCCGACACCT CCTCCATCCC CGGCCACTAC
GTCCTCTTCT GGGAGCTCAC CCCCTCTCCC TCGCCACCGC CGCCGCCATG CCATGACGAC GCCGACGACG CAGCCGACAT
CGGCGAGGAC AAGGACAAGG TGGCACACGT CATGGCGGCG TGCTGCGCCG CCGTGGAGGC CGGGCTGGAC TCGGTGTACC
GGCGGTGCAG GAGCCGGGAC AGGTCGATCG GGCCGCTGGA GATCCGTGTC GTGGCGCCGG GGGCGTTCGA CGCGCTCATG
GACATGTGCG TGTCGCACGG CTCGTCGGTG AACCAGTACA AGACGCCGCG GTGCATCAAG CACCCCGACG CCATCGCCGT
CCTCGAGCAG CGCGTCGTCG GCCGCTTCTT CAGCGACGCC GTCCCGCACT GGGAGCCCCT CAAGGTCGAC GGCGCCGCCG
CCGCCCCCGC CACCGGCAGC GACCAGTGA