Os11t0528700-02

Locus

Os11g0528700

Description

Indole-3-acetic acid (IAA)-amido synthetase

RAP-DB Gene Symbol Synonym(s)

TLD2

RAP-DB Gene Name Synonym(s)

Increased number of tillers, enlarged leaf angles, and dwarfism

CGSNL Gene Symbol

TLD1

CGSNL Gene Name

INCREASED NUMBER OF TILLERS, ENLARGED LEAF ANGLES AND DWARFISM 1

Oryzabase Gene Symbol Synonym(s)

OsGH3-13, GH3-13, TLD1/OsGH3.13, TLD1, OsGH3.13, TLD2

Oryzabase Gene Name Synonym(s)

increased number of tillers, enlarged leaf angles, and dwarfism 1

Transcript Evidence

Inferred from literature

Protein Evidence

Q2R3B4 (UniProt)

Literature

PMID: 19776160

Note

Manual Curation

January 21, 2010

Functional domain (InterPro)

GH3 auxin-responsive promoter (IPR004993)

Others

Oryzabase (11630)

Transcript

1410 bp

>Os11t0528700-02 Indole-3-acetic acid (IAA)-amido synthetase
ATGACGTCCACGTCGTCTGAAAATgcgcccgaccacgaccacgaccacgacgcctcttcg
ccggcgccggcgacggcgacggcggcggcgctgccaccgatgatcccggcgtgcgacccg
cacgacgggccggcgtgcctggagctcatcgaggtgctgaccacgcgcgccgccgccgtc
cagcggcgcgtcctcgccgaggtcctcgccatgaacaccggcaccgactacctccgccgg
TTTCTCGGCGACGAGGTCGTCGCCGCCGCCGGCGGCGAGGACGAGCTCGCCGCGGCGTTC
AAGGAGCGCGTGCCGGTGGTGGAGTACGAGGACGTGAAGCCGTACATCGAGCGCATCGCC
AACGGCGCCCCGTCGTCGCTCATCTCCTCCAAGCCCATCACCGAGCTCCTCACGAGCTCC
GGCACGTCAGGCGGGCAGCCGAAGCTGATGCCGGCGACGGAGGAGGAGCTCGACCGCAAG
ACCTTCCTCTACAACCTCCTCGTCCCCGTCATGAACAAGTACGTGGAGGGGCTGGACGAG
GGGAGGGGGATGTACCTGCTGTTCGTGAAGCCGGAGATCACGACGGCGTCGGGGATGGTG
GCGAGGCCGGTGCTGACGAGCTACTACAAGAGCCGCCACTTCCGGCGGCGGCCGGACAGC
CCGTACACGCGGTACACGAGCCCCGACGCGGCGATCCTCTGCCCGGACAGCCGCCAGAGC
ATGTACGCGCAGCTGCTCTGCGGCctcgcccgccgcggcgaggtgctccgcgtcggcgcc
gtcttcgcctccgccttcctccgcgccgtcaagttcctcgagggccactggcgcgccctc
tgcgccgacatccgcgccggccgcgccgacccggccgtcgtcaccgacgccgcctgccgc
ggcgccgtcgacgccgtcctcgccgcccgcgccgaccccgacctcgccgACGCCATCGCC
GCCGAGTGTGGCGGCGCGTCGTGGCGGGGCATCGTGCGGCGGCTGTGGCCGCGGACCAAG
TACATCGACGTGATCGTGACGGGGTCCATGGCGCAGTACATCCCGCTGCTGGAGTTCTAC
GGCGGCGGGCTGCCGCTGGTGTCGACGATGTACGCGTCGTCGGAGTCCTACTTCGGCATC
AACCTCCGGCCGCTGGACCCGCCGGAGGAGGTGGTGTACACGCTGCTGCCCAACATGTGC
TACTACGAGTTCATCAAGGTGGAGAAGGACGGCGACGGCGAGAAGGTCCGCGACGGCGAG
GTGGTGGACCTCGTCGGCGTCGAGGTCGGCGCCTACTACGAGCTCGTCGTCACCACCTTC
ACAGGTGAGCGCGTGTGCAGCCCGTTCGATTTCTTTCCCACCTCCTGCATGGGTTTATCA
ACGCCGTCCGATCGCAAAATCAACGGCTGA

CDS

1410 bp

>Os11t0528700-02 Indole-3-acetic acid (IAA)-amido synthetase
ATGACGTCCACGTCGTCTGAAAATgcgcccgaccacgaccacgaccacgacgcctcttcg
ccggcgccggcgacggcgacggcggcggcgctgccaccgatgatcccggcgtgcgacccg
cacgacgggccggcgtgcctggagctcatcgaggtgctgaccacgcgcgccgccgccgtc
cagcggcgcgtcctcgccgaggtcctcgccatgaacaccggcaccgactacctccgccgg
TTTCTCGGCGACGAGGTCGTCGCCGCCGCCGGCGGCGAGGACGAGCTCGCCGCGGCGTTC
AAGGAGCGCGTGCCGGTGGTGGAGTACGAGGACGTGAAGCCGTACATCGAGCGCATCGCC
AACGGCGCCCCGTCGTCGCTCATCTCCTCCAAGCCCATCACCGAGCTCCTCACGAGCTCC
GGCACGTCAGGCGGGCAGCCGAAGCTGATGCCGGCGACGGAGGAGGAGCTCGACCGCAAG
ACCTTCCTCTACAACCTCCTCGTCCCCGTCATGAACAAGTACGTGGAGGGGCTGGACGAG
GGGAGGGGGATGTACCTGCTGTTCGTGAAGCCGGAGATCACGACGGCGTCGGGGATGGTG
GCGAGGCCGGTGCTGACGAGCTACTACAAGAGCCGCCACTTCCGGCGGCGGCCGGACAGC
CCGTACACGCGGTACACGAGCCCCGACGCGGCGATCCTCTGCCCGGACAGCCGCCAGAGC
ATGTACGCGCAGCTGCTCTGCGGCctcgcccgccgcggcgaggtgctccgcgtcggcgcc
gtcttcgcctccgccttcctccgcgccgtcaagttcctcgagggccactggcgcgccctc
tgcgccgacatccgcgccggccgcgccgacccggccgtcgtcaccgacgccgcctgccgc
ggcgccgtcgacgccgtcctcgccgcccgcgccgaccccgacctcgccgACGCCATCGCC
GCCGAGTGTGGCGGCGCGTCGTGGCGGGGCATCGTGCGGCGGCTGTGGCCGCGGACCAAG
TACATCGACGTGATCGTGACGGGGTCCATGGCGCAGTACATCCCGCTGCTGGAGTTCTAC
GGCGGCGGGCTGCCGCTGGTGTCGACGATGTACGCGTCGTCGGAGTCCTACTTCGGCATC
AACCTCCGGCCGCTGGACCCGCCGGAGGAGGTGGTGTACACGCTGCTGCCCAACATGTGC
TACTACGAGTTCATCAAGGTGGAGAAGGACGGCGACGGCGAGAAGGTCCGCGACGGCGAG
GTGGTGGACCTCGTCGGCGTCGAGGTCGGCGCCTACTACGAGCTCGTCGTCACCACCTTC
ACAGGTGAGCGCGTGTGCAGCCCGTTCGATTTCTTTCCCACCTCCTGCATGGGTTTATCA
ACGCCGTCCGATCGCAAAATCAACGGCTGA

Protein

470 aa

>Os11t0528700-02 Indole-3-acetic acid (IAA)-amido synthetase
MTSTSSENAPDHDHDHDASSPAPATATAAALPPMIPACDPHDGPACLELIEVLTTRAAAV
QRRVLAEVLAMNTGTDYLRRFLGDEVVAAAGGEDELAAAFKERVPVVEYEDVKPYIERIA
NGAPSSLISSKPITELLTSSGTSGGQPKLMPATEEELDRKTFLYNLLVPVMNKYVEGLDE
GRGMYLLFVKPEITTASGMVARPVLTSYYKSRHFRRRPDSPYTRYTSPDAAILCPDSRQS
MYAQLLCGLARRGEVLRVGAVFASAFLRAVKFLEGHWRALCADIRAGRADPAVVTDAACR
GAVDAVLAARADPDLADAIAAECGGASWRGIVRRLWPRTKYIDVIVTGSMAQYIPLLEFY
GGGLPLVSTMYASSESYFGINLRPLDPPEEVVYTLLPNMCYYEFIKVEKDGDGEKVRDGE
VVDLVGVEVGAYYELVVTTFTGERVCSPFDFFPTSCMGLSTPSDRKING*

CDS

chr11:19189710..19190125 (- strand) : 416 bp

chr11:19189516..19189617 (- strand) : 102 bp

chr11:19188565..19189456 (- strand) : 892 bp

FASTA

>Os11t0528700-02 class=Sequence position=chr11:19188565..19190125 (- strand)
ATGACGTCCA CGTCGTCTGA AAATgcgccc gaccacgacc acgaccacga cgcctcttcg ccggcgccgg cgacggcgac
ggcggcggcg ctgccaccga tgatcccggc gtgcgacccg cacgacgggc cggcgtgcct ggagctcatc gaggtgctga
ccacgcgcgc cgccgccgtc cagcggcgcg tcctcgccga ggtcctcgcc atgaacaccg gcaccgacta cctccgccgg
TTTCTCGGCG ACGAGGTCGT CGCCGCCGCC GGCGGCGAGG ACGAGCTCGC CGCGGCGTTC AAGGAGCGCG TGCCGGTGGT
GGAGTACGAG GACGTGAAGC CGTACATCGA GCGCATCGCC AACGGCGCCC CGTCGTCGCT CATCTCCTCC AAGCCCATCA
CCGAGCTCCT CACGAGGTAA GCTCAAGCTC GATCGATCTC GATCTCGCCA TGGCTAACCT CACAATTTGA CACAATCACT
CGGTCGATCA TGGCGATGTG CGCCGCAGCT CCGGCACGTC AGGCGGGCAG CCGAAGCTGA TGCCGGCGAC GGAGGAGGAG
CTCGACCGCA AGACCTTCCT CTACAACCTC CTCGTCCCCG TCATGAACAA GTGAGTCTCT CTCGCTGGCT TCGCCATCGA
TCGCCATGGA TGCTGACATG GAGGTGCAGG TACGTGGAGG GGCTGGACGA GGGGAGGGGG ATGTACCTGC TGTTCGTGAA
GCCGGAGATC ACGACGGCGT CGGGGATGGT GGCGAGGCCG GTGCTGACGA GCTACTACAA GAGCCGCCAC TTCCGGCGGC
GGCCGGACAG CCCGTACACG CGGTACACGA GCCCCGACGC GGCGATCCTC TGCCCGGACA GCCGCCAGAG CATGTACGCG
CAGCTGCTCT GCGGCctcgc ccgccgcggc gaggtgctcc gcgtcggcgc cgtcttcgcc tccgccttcc tccgcgccgt
caagttcctc gagggccact ggcgcgccct ctgcgccgac atccgcgccg gccgcgccga cccggccgtc gtcaccgacg
ccgcctgccg cggcgccgtc gacgccgtcc tcgccgcccg cgccgacccc gacctcgccg ACGCCATCGC CGCCGAGTGT
GGCGGCGCGT CGTGGCGGGG CATCGTGCGG CGGCTGTGGC CGCGGACCAA GTACATCGAC GTGATCGTGA CGGGGTCCAT
GGCGCAGTAC ATCCCGCTGC TGGAGTTCTA CGGCGGCGGG CTGCCGCTGG TGTCGACGAT GTACGCGTCG TCGGAGTCCT
ACTTCGGCAT CAACCTCCGG CCGCTGGACC CGCCGGAGGA GGTGGTGTAC ACGCTGCTGC CCAACATGTG CTACTACGAG
TTCATCAAGG TGGAGAAGGA CGGCGACGGC GAGAAGGTCC GCGACGGCGA GGTGGTGGAC CTCGTCGGCG TCGAGGTCGG
CGCCTACTAC GAGCTCGTCG TCACCACCTT CACAGGTGAG CGCGTGTGCA GCCCGTTCGA TTTCTTTCCC ACCTCCTGCA
TGGGTTTATC AACGCCGTCC GATCGCAAAA TCAACGGCTG A