Os11t0539200-01

Locus

Os11g0539200

Description

Similar to Xyloglucan endotransglycosylase XET2 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

XTH2

CGSNL Gene Name

XYLOGLUCAN ENDOTRANSGLUCOSYDASE/HYDROLASE 2

Oryzabase Gene Symbol Synonym(s)

OsXTH2, XTR1, OsXTR1

Oryzabase Gene Name Synonym(s)

xyloglucan endotransglucosylase/hydrolase, xyloglucan endotransglucosylase 2, XET-related gene 1

Transcript Evidence

AK071574 (DDBJ, Best hit)

AK061093 (DDBJ, Best hit)

Protein Evidence

E6Y2S0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Biological Process: cellular glucan metabolic process (GO:0006073)

Cellular Component: cell wall (GO:0005618)

Cellular Component: apoplast (GO:0048046)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Molecular Function: xyloglucan:xyloglucosyl transferase activity (GO:0016762)

Functional domain (InterPro)

Glycoside hydrolase, family 16 (IPR000757)

Glycoside hydrolase, family 16, active site (IPR008263)

Concanavalin A-like lectin/glucanase (IPR008985)

Xyloglucan endo-transglycosylase, C-terminal (IPR010713)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Xyloglucan endotransglucosylase/hydrolase (IPR016455)

Full-length cDNA

J023105D14 (Online Clone Ordering)

006-207-A02 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0539200-01)

RiceXPro (AK071574)

Others

Oryzabase (6500)

KEGG (Os11t0539200-01 (EC:2.4.1.207))

Transcript

975 bp

>Os11t0539200-01 Similar to Xyloglucan endotransglycosylase XET2 (Fragment).
CACACAACCACCACTCACCACCAACATGGCGACGACGACGGCGGCGGCGATGGTGGTGGC
AATGTCGGTGCTGCTGCTGGGTGGCGGCGAGGCGGCGGCGCCGCGGAAGCCGGTGGACGT
GGCGTTCGAGAAGAACTACGTGCCGACGTGGGCGGAGGACCACATCCACTACGTGGACGG
CGGGCGCGAGGTGCAGCTCTACCTCGACAAGTCCACCGGCACCGGCTTCCAGACCCGGGG
CTCCTACCTCTTCGGCCACTTCAGCATGCACATCAAGCTCGTCGCCGGCGACTCCGCCGG
CACCGTCACCGCCTTCTACctgtcgtcgcagaactcggagcacgacgagatcgacttcga
gttcctggggaacaggacgggggagccgtacatcctgcagacgaacgtcttctccggcgg
gaagggggaccgggagcagaggatctacctctggttcgaccccaccaaggactaccactc
ctactccgtcctctggaaccTCTACATGATCGCgttcttcgtggacgacacgccgatcag
ggtgttcaagaacagcaaggacctgggcgtgcggtacccgttcaaccagccgatgaagct
ctactccagcctgtggaacgccgacgactgggccacccgcggcgggcgggagaagaccga
ctggtcgcgggcgccgttcgtcgcctcctaccggggcttccacgtcgatggctgcgaggc
gtcggcggaggcccggtactgcgccacccagggcgcccggtggtgggaccagccggagtt
ccgcgacctcgacgccgaccagtaccgccgcctcgcctgggtccgcaagacgcacaccat
ctacaactactgcgacgaccgcgaacgctaccccgccatgtcgcccgagtgcCACCGCGA
CCGCGACGCCTGAGATCTCATCGAGATCTGTGATCGATGCTTGCTGGCCGTCCGATGGAT
GGATGGATGGATGGG

CDS

888 bp

>Os11t0539200-01 Similar to Xyloglucan endotransglycosylase XET2 (Fragment).
ATGGCGACGACGACGGCGGCGGCGATGGTGGTGGCAATGTCGGTGCTGCTGCTGGGTGGC
GGCGAGGCGGCGGCGCCGCGGAAGCCGGTGGACGTGGCGTTCGAGAAGAACTACGTGCCG
ACGTGGGCGGAGGACCACATCCACTACGTGGACGGCGGGCGCGAGGTGCAGCTCTACCTC
GACAAGTCCACCGGCACCGGCTTCCAGACCCGGGGCTCCTACCTCTTCGGCCACTTCAGC
ATGCACATCAAGCTCGTCGCCGGCGACTCCGCCGGCACCGTCACCGCCTTCTACctgtcg
tcgcagaactcggagcacgacgagatcgacttcgagttcctggggaacaggacgggggag
ccgtacatcctgcagacgaacgtcttctccggcgggaagggggaccgggagcagaggatc
tacctctggttcgaccccaccaaggactaccactcctactccgtcctctggaaccTCTAC
ATGATCGCgttcttcgtggacgacacgccgatcagggtgttcaagaacagcaaggacctg
ggcgtgcggtacccgttcaaccagccgatgaagctctactccagcctgtggaacgccgac
gactgggccacccgcggcgggcgggagaagaccgactggtcgcgggcgccgttcgtcgcc
tcctaccggggcttccacgtcgatggctgcgaggcgtcggcggaggcccggtactgcgcc
acccagggcgcccggtggtgggaccagccggagttccgcgacctcgacgccgaccagtac
cgccgcctcgcctgggtccgcaagacgcacaccatctacaactactgcgacgaccgcgaa
cgctaccccgccatgtcgcccgagtgcCACCGCGACCGCGACGCCTGA

Protein

296 aa

>Os11t0539200-01 Similar to Xyloglucan endotransglycosylase XET2 (Fragment).
MATTTAAAMVVAMSVLLLGGGEAAAPRKPVDVAFEKNYVPTWAEDHIHYVDGGREVQLYL
DKSTGTGFQTRGSYLFGHFSMHIKLVAGDSAGTVTAFYLSSQNSEHDEIDFEFLGNRTGE
PYILQTNVFSGGKGDREQRIYLWFDPTKDYHSYSVLWNLYMIAFFVDDTPIRVFKNSKDL
GVRYPFNQPMKLYSSLWNADDWATRGGREKTDWSRAPFVASYRGFHVDGCEASAEARYCA
TQGARWWDQPEFRDLDADQYRRLAWVRKTHTIYNYCDDRERYPAMSPECHRDRDA*

5'UTR

chr11:19675012..19675036 (+ strand) : 25 bp

CDS

chr11:19675037..19675330 (+ strand) : 294 bp

chr11:19675426..19675619 (+ strand) : 194 bp

chr11:19677354..19677753 (+ strand) : 400 bp

3'UTR

chr11:19677754..19677815 (+ strand) : 62 bp

FASTA

>Os11t0539200-01 class=Sequence position=chr11:19675012..19677815 (+ strand)
CACACAACCA CCACTCACCA CCAACATGGC GACGACGACG GCGGCGGCGA TGGTGGTGGC AATGTCGGTG CTGCTGCTGG
GTGGCGGCGA GGCGGCGGCG CCGCGGAAGC CGGTGGACGT GGCGTTCGAG AAGAACTACG TGCCGACGTG GGCGGAGGAC
CACATCCACT ACGTGGACGG CGGGCGCGAG GTGCAGCTCT ACCTCGACAA GTCCACCGGC ACCGGCTTCC AGACCCGGGG
CTCCTACCTC TTCGGCCACT TCAGCATGCA CATCAAGCTC GTCGCCGGCG ACTCCGCCGG CACCGTCACC GCCTTCTACG
TACGCCGCCG CCATTGCTCC CTGATCCTCT TCCCCTTCTG CTTCTTGATC GGAGATCGAT GATGTGTGGT TTTTTTGCAT
TGGGGAATTT GCAGctgtcg tcgcagaact cggagcacga cgagatcgac ttcgagttcc tggggaacag gacgggggag
ccgtacatcc tgcagacgaa cgtcttctcc ggcgggaagg gggaccggga gcagaggatc tacctctggt tcgaccccac
caaggactac cactcctact ccgtcctctg gaaccTCTAC ATGATCGCGT ACGCTAATTA CCCCTCATTA ACACCCCCAC
TTATTTACTT GCATTGTACT CCCTCATTTT CCGAAGAAAA TAAAAATAAG GAAGCACAAT CTACAACTAT CAACTCTGGT
AAACTTTGAG ATTCGTAGTA TTAAAATATT TTATAATatc tttataatgt cgttaatttt ttatctaacg tttgatcatt
cgtcttataa aaaaattatg taattatcat ttattttatt gtgattttaa gtatgacata aatattttca tatttgcata
aaaaatttga ataaaatgaa tagtcaaacg ttataaaaaa tgtattatat attaaaatac agaCAGTATA TTTTAAGACA
AATAGAGTTG TAGAATTATg ctgtgtttag attggcccaa agtttaaaat ttgattgaaa ttggagacga tgtgactaaa
aggttgtgtg ttgtatgaaa ggttcgatgt gatggaaagt tggaagtttg aaaaaaaact ttgaaactaG TATATGAGTA
TATTATAGCC CGGGAGAGTA TTACATTAGC AGAATGATTT TCTCTTTTTT TTTCCTCAAA ATGTAGCCAG GTAGGATGGG
TCTAATCCTG CCTTAGACTG GGATGAAAGT AGTAAGAGTA ATTAGTGCGG TGTCAGTAGT ACTAAGATGC TTTGAATCCA
CCGTAAAGAT GAGCAAAGCA AAAGGTACCT GCACGGTGAG ACGAGAGATT GGCGCGCATG TGCAATTGAT TTTGGCGCGC
GTGTACATGT CGTCCCTGAC CAGCAGAGTT CAGAAAGAAC ATGAAAAGCA GGGATGGGTC GGTCGGCGGT GGGGCCCACA
CGCTGACACG CGCCGATGCT ACAGCGTTGC ACAGTGCGAA CAAGAAGCGG ATAGCCGCTG TGCGCTAACA GTTTATTGAA
AGCAAACCGC AATAAATTAA AAGCTAGTAG TAGTAGTATT AACTGAAATT ACTACTCCTA CTACTACTTG ATGAAAATAC
TATGTATTTC CTGTGTTCCA GTAAAATCCT ATGATAGCCC TATTATATTT CTAAATTTCA GATTTTCCAG TGCAAGTTTT
TATTTCTATA TAATTTTTTT TTCTTGTAAT ACATTTCTGC AACATTTCCT TAATTTTTTT TATAGTAGTT AACTCATTTA
TTTATACACA TAAGTTTTGT TATAGAAAAT TATAGATTAC CCATTTATGA ACCAATTTTA GCTGTCTCAG TCGGGTCTAG
AATCTACATA AAAATCCAGT AAAATTCATA CGTTCTAAAT GTATATATAT ACATGTGCAG GTTAATTATT TCCCATCAAT
TTATACACAC AAAATGTTAT GAAAAAATGT ACAGCTATCT CAAACAGATC TAAAATCTAC CTCATCCGTT TCATATTATA
AGTTGTTTAa aagtcaaact actttaaatt tgatcaagtt tgtaaacaaa tatagtaata tttacagtag caaattaatt
ttattaagtc tacaatttaa atacatcttc ataatatatt tgtgttgggt tgaaaatgtt actatttttt ttctacaaac
ttgattaaac ttagaacatt ttaacttCCA TCGAAGTCAA AACGACGATG AAACGAGAGC AGTTTGATTT TAATAAAAAT
CAAAGCAACT TGTAATCTGA AACGGAGGGA GCACATGAAA ATCCTGTAAA CTTCATACGT ACGTTCTGAA ATCTGaatgt
atcgatctat caatatatgc aggttcttcg tggacgacac gccgatcagg gtgttcaaga acagcaagga cctgggcgtg
cggtacccgt tcaaccagcc gatgaagctc tactccagcc tgtggaacgc cgacgactgg gccacccgcg gcgggcggga
gaagaccgac tggtcgcggg cgccgttcgt cgcctcctac cggggcttcc acgtcgatgg ctgcgaggcg tcggcggagg
cccggtactg cgccacccag ggcgcccggt ggtgggacca gccggagttc cgcgacctcg acgccgacca gtaccgccgc
ctcgcctggg tccgcaagac gcacaccatc tacaactact gcgacgaccg cgaacgctac cccgccatgt cgcccgagtg
cCACCGCGAC CGCGACGCCT GAGATCTCAT CGAGATCTGT GATCGATGCT TGCTGGCCGT CCGATGGATG GATGGATGGA
TGGG