Os11t0546300-01

Locus

Os11g0546300

Description

Patatin family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OspPLAV, pPLAV

Oryzabase Gene Name Synonym(s)

Patatin-related phospholipase A V

Transcript Evidence

AK121962 (DDBJ, Best hit)

Protein Evidence

A2Q497 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid metabolic process (GO:0006629)

Biological Process: metabolic process (GO:0008152)

Functional domain (InterPro)

Patatin/Phospholipase A2-related (IPR002641)

Acyl transferase/acyl hydrolase/lysophospholipase (IPR016035)

Full-length cDNA

J033108B06 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0546300-01)

RiceXPro (AK121962)

Others

Oryzabase (19879)

KEGG (Os11t0546300-01)

Transcript

1409 bp

>Os11t0546300-01 Patatin family protein.
ACACGTGTCGTCGTCGGCGGCCGCCGGCGAGCCCCCATGGCCTCCTCCCTCCTCTCCTCC
GCCGCCTCCGGCCTCCCTCCCAAGCCGCAGCCACCTTCCTCCACCCCTCCCTCCTCCGCC
TCCGCGCGGCCGCGGGGCTTCCGTCGCTTCATGCTCGCCCGCGCCGCCGCGGGCCGCGAC
CCGGAGCCGCCGCCGCTGCCCGAGGGGACCGAGAAGAGGTCGCTCGCGGTGAGGACGGGG
GAGGTGTTCCTGGGGCTGGCGGCGCTGCTGGTGCGCGCGGGGAGGGGCGGGGGGGCGGCG
GTGGAGGAGGTGGAGGCGAAGGACGGGGTGGTGTGGGAGCAGCGGCCCGAGGACGTGGAG
GCGGAGCGGCGGCGGCGGGAGCTGACCGGCCCCGGGTTCAGCTTCTCCGCCGCCGGGCTG
CTCTTCCCCTACCACATCGGCGTCGCGCAGTGCCTCATCGACAGGGGCTACCTCACGGAA
AGAACTCCGTTAGCTGGTTCATCAGCTGGTGCCATAATCTGTGCAGTGATTGCATCTGGG
AACACGATGCGAGATGCTTTGCAAGTGACCAAGGATCTAGCTGATAACTGTCGGAGCAAT
GGGACAGCCTTTCGCCTTGGGGCTGTACTCAAGGATGTTCTAGACAGGTTTCTCCCAGAT
GATGTGCACATTAGGTGCAACGGAAGGATCCGTGTTGCTATTACTCAGCTGTCCTGGAGG
CCTAGGGGCTTACTGGTTGACCAATTTGACTCAAAAGATGATGTAATCAGTGCAGTTATT
ACATCCTCTTTTATTCCTGGATATTTAGCTCCCAGGCCTGCAACTTTCTTCCGGAACAGG
CTGTGCATTGATGGGGGCCTTACGTTGTTTATGCCACCAACTTCTGCTTCCGAAACAGTT
CGAATTTGTGCTTTCCCAGCCAGTCGACTAGGATTGCAAGGGATTGGTATTAGTCCAGAC
TGCAATCCGGAGAACAGAGCTAGCCCCCGACAGCTGTTTAACTGGGCTCTGGAACCCGCC
GAAGACGAGGTTCTAGACAAATTATATGAGCTTGGGTATCTGGATGCAGCTGTATGGGCT
GACCAGAATCAAGTTGAGTTGATTGTGAAGAATGAACAGCCACTCCGCGTCACAGATTGA
GAAGACACCAACAAGAAGACCCTGAGTTCTTGAACCTAACAGTATTTGGTTTGCTCAAAA
GCTAACATCTGAATCTGTTTGCCCCAGCTGTGCTCAGAAGTCTCTCACGTACAACTGCAT
CAGCTGTATTTCTTTTCCCAAATTTTGCCAGCTCTAGGTTACCAGTTCAATACTACAATG
GTTTGTAAAGTGTGACTGCTGCAACCACACGAGAGCTTTACTATGCTACTCGTTGCCTTG
ATTTTGCAGTAAATATTGTTTTGTCCTCC

CDS

1104 bp

>Os11t0546300-01 Patatin family protein.
ATGGCCTCCTCCCTCCTCTCCTCCGCCGCCTCCGGCCTCCCTCCCAAGCCGCAGCCACCT
TCCTCCACCCCTCCCTCCTCCGCCTCCGCGCGGCCGCGGGGCTTCCGTCGCTTCATGCTC
GCCCGCGCCGCCGCGGGCCGCGACCCGGAGCCGCCGCCGCTGCCCGAGGGGACCGAGAAG
AGGTCGCTCGCGGTGAGGACGGGGGAGGTGTTCCTGGGGCTGGCGGCGCTGCTGGTGCGC
GCGGGGAGGGGCGGGGGGGCGGCGGTGGAGGAGGTGGAGGCGAAGGACGGGGTGGTGTGG
GAGCAGCGGCCCGAGGACGTGGAGGCGGAGCGGCGGCGGCGGGAGCTGACCGGCCCCGGG
TTCAGCTTCTCCGCCGCCGGGCTGCTCTTCCCCTACCACATCGGCGTCGCGCAGTGCCTC
ATCGACAGGGGCTACCTCACGGAAAGAACTCCGTTAGCTGGTTCATCAGCTGGTGCCATA
ATCTGTGCAGTGATTGCATCTGGGAACACGATGCGAGATGCTTTGCAAGTGACCAAGGAT
CTAGCTGATAACTGTCGGAGCAATGGGACAGCCTTTCGCCTTGGGGCTGTACTCAAGGAT
GTTCTAGACAGGTTTCTCCCAGATGATGTGCACATTAGGTGCAACGGAAGGATCCGTGTT
GCTATTACTCAGCTGTCCTGGAGGCCTAGGGGCTTACTGGTTGACCAATTTGACTCAAAA
GATGATGTAATCAGTGCAGTTATTACATCCTCTTTTATTCCTGGATATTTAGCTCCCAGG
CCTGCAACTTTCTTCCGGAACAGGCTGTGCATTGATGGGGGCCTTACGTTGTTTATGCCA
CCAACTTCTGCTTCCGAAACAGTTCGAATTTGTGCTTTCCCAGCCAGTCGACTAGGATTG
CAAGGGATTGGTATTAGTCCAGACTGCAATCCGGAGAACAGAGCTAGCCCCCGACAGCTG
TTTAACTGGGCTCTGGAACCCGCCGAAGACGAGGTTCTAGACAAATTATATGAGCTTGGG
TATCTGGATGCAGCTGTATGGGCTGACCAGAATCAAGTTGAGTTGATTGTGAAGAATGAA
CAGCCACTCCGCGTCACAGATTGA

Protein

368 aa

>Os11t0546300-01 Patatin family protein.
MASSLLSSAASGLPPKPQPPSSTPPSSASARPRGFRRFMLARAAAGRDPEPPPLPEGTEK
RSLAVRTGEVFLGLAALLVRAGRGGGAAVEEVEAKDGVVWEQRPEDVEAERRRRELTGPG
FSFSAAGLLFPYHIGVAQCLIDRGYLTERTPLAGSSAGAIICAVIASGNTMRDALQVTKD
LADNCRSNGTAFRLGAVLKDVLDRFLPDDVHIRCNGRIRVAITQLSWRPRGLLVDQFDSK
DDVISAVITSSFIPGYLAPRPATFFRNRLCIDGGLTLFMPPTSASETVRICAFPASRLGL
QGIGISPDCNPENRASPRQLFNWALEPAEDEVLDKLYELGYLDAAVWADQNQVELIVKNE
QPLRVTD*

5'UTR

chr11:20147862..20147897 (- strand) : 36 bp

CDS

chr11:20147421..20147861 (- strand) : 441 bp

chr11:20146717..20146860 (- strand) : 144 bp

chr11:20146316..20146388 (- strand) : 73 bp

chr11:20146090..20146195 (- strand) : 106 bp

chr11:20145899..20145995 (- strand) : 97 bp

chr11:20145107..20145202 (- strand) : 96 bp

chr11:20144878..20145024 (- strand) : 147 bp

3'UTR

chr11:20144609..20144877 (- strand) : 269 bp

FASTA

>Os11t0546300-01 class=Sequence position=chr11:20144609..20147897 (- strand)
ACACGTGTCG TCGTCGGCGG CCGCCGGCGA GCCCCCATGG CCTCCTCCCT CCTCTCCTCC GCCGCCTCCG GCCTCCCTCC
CAAGCCGCAG CCACCTTCCT CCACCCCTCC CTCCTCCGCC TCCGCGCGGC CGCGGGGCTT CCGTCGCTTC ATGCTCGCCC
GCGCCGCCGC GGGCCGCGAC CCGGAGCCGC CGCCGCTGCC CGAGGGGACC GAGAAGAGGT CGCTCGCGGT GAGGACGGGG
GAGGTGTTCC TGGGGCTGGC GGCGCTGCTG GTGCGCGCGG GGAGGGGCGG GGGGGCGGCG GTGGAGGAGG TGGAGGCGAA
GGACGGGGTG GTGTGGGAGC AGCGGCCCGA GGACGTGGAG GCGGAGCGGC GGCGGCGGGA GCTGACCGGC CCCGGGTTCA
GCTTCTCCGC CGCCGGGCTG CTCTTCCCCT ACCACATCGG CGTCGCGCAG TGCCTCATCG ACAGGGGCTA CCTCACGGTG
CGCGTCCACC CCCCATCTCT CTTACCTCTT CTACGCGAAC GCGTACTTGA TTTTTGCAGT AGGAGACAGG AGCTTCTGCT
CAGATGAATT GTGAGATCCG TGTGCCTACG ATAGTGGAGA TTGTTTCTCT CTCGAGATGA AATTGTGGCC AACAACAATC
CAATTTACGT TTGTCTGCTT AGCTATTGGG GCTTGTTTCT TTGAGATGAA ATTATGGCTA ACAACAATCC AATTCACATT
GGTCTCTTTA GCCAATGAGC GGGTTACTTT CGAGATGAAA TTGTGGCTAA CAACAGTCGA ATTTCCGTGT TGGTCTCTTT
AGCTTAGTAG GAGTAGTAGG AGTAGCTTGT TGGTGCCATG GCTGGCTAGA GCTCTCAATT TTTATGCTAC TGTACTGTCT
AGGTGGTAAC ATTGCCTGCT ATTTTTATGC ATGGAAATTC TGCATTCCTA TGCTTGTGAT TTTAGGACTT ACGTGTGATA
CATTTTGTAT GTATGCTGCT GCTTTTTTTT TTAGCAAGTT TTCTTATAGT GGTTTCTTTA TCTGGGACTT ACATTAGGAA
AGAACTCCGT TAGCTGGTTC ATCAGCTGGT GCCATAATCT GTGCAGTGAT TGCATCTGGG AACACGATGC GAGATGCTTT
GCAAGTGACC AAGGATCTAG CTGATAACTG TCGGAGCAAT GGGACAGCCT TTCGCCTTGG GGTAAGTTTT CTGTTTCCAT
TTATTGTTTA CTTTTAATTA TACTTGCGGC CAACATGTGA GTTTGCTTCC TGTGTAAATT ATACCCAACT ATATGTGTGA
TAGATCATTG GTTTATTTAT GACCAATTTG CCAACTATGT TTCAACTTTG CAATACCTTG GTGTTTAGAC TGTAATAATT
CGAGAAAACT GTGATGAGTA ACCTGGTGTA TCCTTTAAAA AATACGCTGA AGGCGACAGA CATATATGGC ACTCAAGTCA
CTAAATAGTT CATGTGCTGG CTGATTGAAT GATATGTTTT TAACCTTGTA ATCTTGTGCA CTTGAGCAGG CTGTACTCAA
GGATGTTCTA GACAGGTTTC TCCCAGATGA TGTGCACATT AGGTGCAACG GAAGGATCCG TGGTAAGCTT CATACTGTTC
AACCATTGCT TATTCATATT TGCTGTGTGT ATTTTCTGCT ACATTATTTT CTGACAAGTA ACTGGATTTA ATAATTAAGA
ACACTTAACT TCTTCTCATC AGTTGCTATT ACTCAGCTGT CCTGGAGGCC TAGGGGCTTA CTGGTTGACC AATTTGACTC
AAAAGATGAT GTAATCAGTG CAGTTATTAC ATCCTCTTTT ATTCCTGGGT AAGATTCATG TTAACTTTTC CTCACTCGTA
CTGTATGTAT CTTCTATATT TTGTGTTCTA AGTTTAAGAA TAATTGGGTG TGCTTGTTTC AGATATTTAG CTCCCAGGCC
TGCAACTTTC TTCCGGAACA GGCTGTGCAT TGATGGGGGC CTTACGTTGT TTATGCCACC AACTTCTGCT TCCGAAACAG
TATGTCATAA CTTCTTTTGG TTCTGCAAAA TTATTCTGAT CACTAGAACT ATTGAGTTTT CTGCACATGT ATGAAAAGCA
TTTCCCCCAC TGATTGTTGA TTTTACAATT GAAAACCGTA TGACATGTCT GTCTTGGTTA GACTATGATT TTGAACAATG
CAACATAGGG ACACCTCAGA CATGTTTTGT TCTGTAGTAG GTGCAAGCAC TGTGATGTGT TCATGTACTA AAATGATCAT
AAGCTGAGTA CATAATAATG TGTTTTTCTT CTCAAATTTA ATACATTTTC TGTTGCTCTC TTTATACTTT ACAGTGAAGA
TAACTGTATA ACCTGAATTT GGGGTATCTT CTTTCTTTTC CTTTTCCATA ACTGAGCAAT CTGTTTTAAA AAACTGTACT
GAAATTTGAA TGTGCAATTC TGAAACCGCT TCTTCTGAAT GGGCGTGTGC AAGTTGGCCT GTCTCATGCA GGATGCATCA
CACTTGTGAG TTGAGGGCTT CTCTGTCTCC AAAAATATTC TACTCTGAGT TTTTTTTTTA CCGGAAACAG TGAGGGAGGC
CCCCCACGAT ATCCATTAGC AGAACCAGTT GCGTTGTACT ACTTTGTGTA CACATCTTTG ATGCATACAA CAGGACAATG
TGCCATGCTG CCTGTTTTGC AATGCTTATT CTTGACACTA TGCCTACAAT TGCAGGTTCG AATTTGTGCT TTCCCAGCCA
GTCGACTAGG ATTGCAAGGG ATTGGTATTA GTCCAGACTG CAATCCGGAG AACAGAGCTA GCCCCCGACA GGTCAGTCAC
TTTCGAAATG CACAATTTTT ACCACTCACC TTGATTCACT TTGACACTGT CTCAATTCTC AAATCAATTA CAGCTGTTTA
ACTGGGCTCT GGAACCCGCC GAAGACGAGG TTCTAGACAA ATTATATGAG CTTGGGTATC TGGATGCAGC TGTATGGGCT
GACCAGAATC AAGTTGAGTT GATTGTGAAG AATGAACAGC CACTCCGCGT CACAGATTGA GAAGACACCA ACAAGAAGAC
CCTGAGTTCT TGAACCTAAC AGTATTTGGT TTGCTCAAAA GCTAACATCT GAATCTGTTT GCCCCAGCTG TGCTCAGAAG
TCTCTCACGT ACAACTGCAT CAGCTGTATT TCTTTTCCCA AATTTTGCCA GCTCTAGGTT ACCAGTTCAA TACTACAATG
GTTTGTAAAG TGTGACTGCT GCAACCACAC GAGAGCTTTA CTATGCTACT CGTTGCCTTG ATTTTGCAGT AAATATTGTT
TTGTCCTCC

Locus: Os11g0546300

Loading...

Locus: Os11g0546300

Loading...