Os11t0549300-00

Locus

Os11g0549300

Description

Similar to Protein kinase domain containing protein, expressed.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK330

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 330

Oryzabase Gene Symbol Synonym(s)

OsLysM-RLK8, OsRLCK330

Oryzabase Gene Name Synonym(s)

LysM receptor-like kinase 8

Transcript Evidence

FP096992 (DDBJ)

Protein Evidence

Q2R2U0 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Expression Databases

TENOR (Os11t0549300-00)

Others

Oryzabase (10927)

Transcript

1148 bp

>Os11t0549300-00 Similar to Protein kinase domain containing protein, expressed.
AACCATCTGATCAGGTCACATAATCACATTTATATCCTATATGCGGTTGTTAAGATAGTT
ATTTTCATTTTGACAGGGTTGATTAATCAGGAGGACATTAATATTGATCTCTCGACTTTG
CGAACAGCAACAAATAACTTTGATGAACGAAATAAGCTCGGAGAAGGTGGTTTTGGTGTG
GTCTACAAGGGAGCTCTTCCAGATGGACAACAGATAGCAGTGAAGAGGCTCTCAAATTGT
TCAAGGCAAGGAATAAATGAACTGAAAAATGAGCTAGTTTTGGTTAGCAAGCTTCAACAC
AAAAATCTTGTGAGACTTGTTGGTGTTTGTGTGGAAAACCAAGAAAAGTTGCTCGTGTAT
GAGTACATGCCCAAAAGAAGCTTGGATACCATCCTTTTCGATCCGGATAAAAGCAGGGAA
TTAAGTTGGGAGAAGAGATTGAAAATCATAATTGAAATTGCTCGAGGTTTAGAGTACCTG
CATGAAGAGTCTAGATTGAAGATCATCCACCGCGATCTCAAGGCAAATAACATTCTATTA
GACTCCGATTTGACTCCAAAGATTTCAGACTTTGGATTGGCAAAGTTATTTGGAGCAGAT
CAATCTCATGTTATCACAAATCGAGTAGCTGGGACATATGGATATATGGCACCTGAATAC
GCAATGTTTGGACAATATTCCGTCAAGTCTGATGTATTCAGCTTTGGTGTTCTTATTCTA
GAGATTGTCACAGGAAGAAGAAGCATGGGCTCATACAGTGATCATGAGCAATCTTTCAAC
CTCTTAGACCTTATTTGGCAGCACTGGAACAGGGGAACACTTCTAGAGCTGGTGGATCCG
TCGACACTGACCAGAGCTGGCCATGGCACCACCAACCAGTGCTCTCTCCAGGCTGACCAG
ATGCTGGGGTGCATCCATGTCGGCCTACTCTGCGTGCAGGCGAACCCCGCCGACCGCCCG
AAGCTGTCGGCGGTGACCACGATGATCGGCGGCACGGCGTCGCTCAACCCTCCGTCGAGG
CCGGCGTTCTGGGTACTCCCGGAGGAGGATGCGACGCGGGCAGCCGGCACCAATTCTTCG
CCAGGCGGCAGGGTGATGGCCGCGTCGGCCAACCGTGTCTCCATCACCGAAATCGAGCCA
AGATAGGT

CDS

1146 bp

>Os11t0549300-00 Similar to Protein kinase domain containing protein, expressed.
AACCATCTGATCAGGTCACATAATCACATTTATATCCTATATGCGGTTGTTAAGATAGTT
ATTTTCATTTTGACAGGGTTGATTAATCAGGAGGACATTAATATTGATCTCTCGACTTTG
CGAACAGCAACAAATAACTTTGATGAACGAAATAAGCTCGGAGAAGGTGGTTTTGGTGTG
GTCTACAAGGGAGCTCTTCCAGATGGACAACAGATAGCAGTGAAGAGGCTCTCAAATTGT
TCAAGGCAAGGAATAAATGAACTGAAAAATGAGCTAGTTTTGGTTAGCAAGCTTCAACAC
AAAAATCTTGTGAGACTTGTTGGTGTTTGTGTGGAAAACCAAGAAAAGTTGCTCGTGTAT
GAGTACATGCCCAAAAGAAGCTTGGATACCATCCTTTTCGATCCGGATAAAAGCAGGGAA
TTAAGTTGGGAGAAGAGATTGAAAATCATAATTGAAATTGCTCGAGGTTTAGAGTACCTG
CATGAAGAGTCTAGATTGAAGATCATCCACCGCGATCTCAAGGCAAATAACATTCTATTA
GACTCCGATTTGACTCCAAAGATTTCAGACTTTGGATTGGCAAAGTTATTTGGAGCAGAT
CAATCTCATGTTATCACAAATCGAGTAGCTGGGACATATGGATATATGGCACCTGAATAC
GCAATGTTTGGACAATATTCCGTCAAGTCTGATGTATTCAGCTTTGGTGTTCTTATTCTA
GAGATTGTCACAGGAAGAAGAAGCATGGGCTCATACAGTGATCATGAGCAATCTTTCAAC
CTCTTAGACCTTATTTGGCAGCACTGGAACAGGGGAACACTTCTAGAGCTGGTGGATCCG
TCGACACTGACCAGAGCTGGCCATGGCACCACCAACCAGTGCTCTCTCCAGGCTGACCAG
ATGCTGGGGTGCATCCATGTCGGCCTACTCTGCGTGCAGGCGAACCCCGCCGACCGCCCG
AAGCTGTCGGCGGTGACCACGATGATCGGCGGCACGGCGTCGCTCAACCCTCCGTCGAGG
CCGGCGTTCTGGGTACTCCCGGAGGAGGATGCGACGCGGGCAGCCGGCACCAATTCTTCG
CCAGGCGGCAGGGTGATGGCCGCGTCGGCCAACCGTGTCTCCATCACCGAAATCGAGCCA
AGATAG

Protein

382 aa

>Os11t0549300-00 Similar to Protein kinase domain containing protein, expressed.
NHLIRSHNHIYILYAVVKIVIFILTGLINQEDINIDLSTLRTATNNFDERNKLGEGGFGV
VYKGALPDGQQIAVKRLSNCSRQGINELKNELVLVSKLQHKNLVRLVGVCVENQEKLLVY
EYMPKRSLDTILFDPDKSRELSWEKRLKIIIEIARGLEYLHEESRLKIIHRDLKANNILL
DSDLTPKISDFGLAKLFGADQSHVITNRVAGTYGYMAPEYAMFGQYSVKSDVFSFGVLIL
EIVTGRRSMGSYSDHEQSFNLLDLIWQHWNRGTLLELVDPSTLTRAGHGTTNQCSLQADQ
MLGCIHVGLLCVQANPADRPKLSAVTTMIGGTASLNPPSRPAFWVLPEEDATRAAGTNSS
PGGRVMAASANRVSITEIEPR*

CDS

chr11:20270483..20270671 (+ strand) : 189 bp

chr11:20271519..20271729 (+ strand) : 211 bp

chr11:20271820..20272057 (+ strand) : 238 bp

chr11:20272222..20272375 (+ strand) : 154 bp

chr11:20275537..20275890 (+ strand) : 354 bp

3'UTR

chr11:20275891..20275892 (+ strand) : 2 bp

FASTA

>Os11t0549300-00 class=Sequence position=chr11:20270483..20275892 (+ strand)
AACCATCTGA TCAGGTCACA TAATCACATT TATATCCTAT ATGCGGTTGT TAAGATAGTT ATTTTCATTT TGACAGGGTT
GATTAATCAG GAGGACATTA ATATTGATCT CTCGACTTTG CGAACAGCAA CAAATAACTT TGATGAACGA AATAAGCTCG
GAGAAGGTGG TTTTGGTGTG GTCTACAAGG TATCAACATT ATTTAACAAA ATCCGGCGTA GATGATTTGT ACTTAATTGA
TAGTAGAAGT TGTCGGCACG TCATTGCTTT TGTTTTGATG TTCAAACAAG TTAACAAAAC GAAGCAAATC CTTTTATCAT
TCATACACAA CCTATAACTC ATTTTCAAGT TTTTTTATAT ATAATGTAAA TGGTTTACAT CTCCGGCTTA TGCCCTAATG
CACACAACCA TAAGATTGTT TACCAAATAA AAAAGAGATA ATAGATGATA AAACAAACCC CCTACTCCCC TTTATTAGTA
ACTAGCGTTA AACCATATAG ATTCAACCAG CAATTCTAAT AGAACTACGC CACCCATACT GGAATAAGAG ACCCTTCGCT
ACCAATTCTA AAAGTATAGC ACCACTGCAC ATAATATCCT ACTCCTCATG TGGTTGCATC ATAGATCAAA AGTGGAGCTA
ATACGAAAAT ATGAAGATAA CCTGCATCGG GTTAGACAAT TGCTTACCAT Taaaaacttt atcattacgg cacttccaaa
ttgaccaaca taaagcacta gctcaaatta atatcatctt ttacatagac ctaggcattc ctctaagcca attaccaaaa
atatttttgg cattatgagg tggatgaata ttaaaatcaa agaacacaca tatctaaata aatcgagcaa tatgacacgc
aaagaaaaga tgatggattg tctcttttgc tggaaaaaaa aacaatattt gcCCCCCCCC CTCCCCCCCA ACACACACAT
TCGTTTAGCC AGCTTACCTT TTCAAGTTCT TTACAACATG TTTTACATAT ATATTTGCAA ATTCACACAT GGACAGGGAG
CTCTTCCAGA TGGACAACAG ATAGCAGTGA AGAGGCTCTC AAATTGTTCA AGGCAAGGAA TAAATGAACT GAAAAATGAG
CTAGTTTTGG TTAGCAAGCT TCAACACAAA AATCTTGTGA GACTTGTTGG TGTTTGTGTG GAAAACCAAG AAAAGTTGCT
CGTGTATGAG TACATGCCCA AAAGAAGCTT GGATACCATC CTTTTCGGTA TGTTTATTTC TTTCAAAACA AATTAGTTGT
TATTTCCATT AAAAAATTCC ATAGTAGAGA TATCTATACT TCTTCTTCGA GTGGCAGATC CGGATAAAAG CAGGGAATTA
AGTTGGGAGA AGAGATTGAA AATCATAATT GAAATTGCTC GAGGTTTAGA GTACCTGCAT GAAGAGTCTA GATTGAAGAT
CATCCACCGC GATCTCAAGG CAAATAACAT TCTATTAGAC TCCGATTTGA CTCCAAAGAT TTCAGACTTT GGATTGGCAA
AGTTATTTGG AGCAGATCAA TCTCATGTTA TCACAAATCG AGTAGCTGGG ACATAGTAAG TAAAATATCA CAATTCAATA
TATATAATCG ATAGAGATAT AATATAGAAA GTACACCCAG TGAATGGGAA TGACGATCAT GAGCCTATAT AAAGCTGGAT
TCTATTTATT CTTATGACCT TTTATGAGAA TAGATGATAA TTGTTTTCAA TTTTTACAGT GGATATATGG CACCTGAATA
CGCAATGTTT GGACAATATT CCGTCAAGTC TGATGTATTC AGCTTTGGTG TTCTTATTCT AGAGATTGTC ACAGGAAGAA
GAAGCATGGG CTCATACAGT GATCATGAGC AATCTTTCAA CCTCTTAGAC CTTGTGAGTT TGACCATGCA TATTATATTC
CTACTAAGAA TATGAATTAT AAGCTCTAAT GTTTTTTCAG TTATCCTTCA TATCCAAAAA TTAATATATT AATGCTCTGA
CGTTTATAAA TTCTTTTAGA TAGAAGAAAC ATATTGCCGG CCAGCCTCTG AAGATTTGTA AATGAtacta cctccctttt
taatatatga tgccgttgac tttttaccaa cgtttaacca ttcatcttat tcaatttttt tttcaaatat aaaaatattt
aagtcatgct taaagaacat ttgatgataa atcaagtcac aataaaataa ataataatta tacgattttt ttaataagac
gaatggttaa acgtatctca aaaagttaac ggcgtcgtat attacaaaac ggaaggaGTA CTATACATAT GTATACATAT
GGTTTAGGTA GAGCTAAGAT GCATGTGTTA GAACACGCAA GGATTTGTGT GTGCATTCGT AGAGCGTGCG CCGGATGCGC
GTCTTTGGCA TTATCTTGAA GCTGGAAATT AGCTTGTGAG CATCAATTTG ATAATAATCT AGAGAATTAA CATACCTATC
TATCGGTTAC TACTACATTT AAATTCTGTA GCTACTAAGA ATGGAGTAAA GAATGTACTA CGAAGATGGA GATCGCAATT
CTAGTAGCAG CTGAAGATTT TAGAATGGCT ACATTTATTA GAAGCTCCCT AGATAGAATC TTAAGCTGCA TACTTTCTAA
ACTAGTATTT ACATATCAAA ATTATTGAAA ATGATCCACT TTACTCCCTA ATATAACTAT TTTTCTGTTT TATTTGTCCC
TATATAACTC GTATTTTGCA CTATAATTTG ATTGGATGAT GATATATTTT ATTACAACTT ACGTCGCCGC ATTATTTTTA
GAAATTTTTA TCATCGTTTA CAAAGGTCGA AGCAACCTAA GATTGATTAA AACATTGTAC ATATGAAGTT CATGTAATAA
TGAAAGAAGT TTTGAACTTT GTTAATGGTG TCACCAATAG CCCTACAAAA TTGCAGCTTA AAATACAACT TAATTACACa
aaggaaaaag tccaaataac cccctaaact ttggatgaaa gtccatctaa caccctgaac tttgaaaccg gtcattcaac
cccctaaact ttacaatacc atttatataa tctcctaaga tggttttaca taatggtttt tatctaattt gtatataagc
tagatgagtt tgatcacatg tcatacactt tttgcttatt attagctttc atttacaaac aagtaccaac ataataataa
tagtatgatg tcactctaca aaaataaatt gataacttat aactgatgat atgcaaatat gttatattag ttattcaaaa
ttgtttgttt aagcttccaa attatgcaaa accatcatcc aaaaccacct aaaggagtaa tatggttggt atggcaaagt
ttagggggtt ggatgtctaa ttttaaagtt cagggtgcta gacagacttc catctaaagt ttagggggat atttgaaatt
tttccttATA CAAATAGAGC AAAAATAAAT ATTATTTGGT AATTGAATGA ACCAATGTTT TACGGATAAA ATAAAAAAAT
TTTACAGGAT ATGAAGTGCT CTAATAAAAT GGTTCGTGGG AGTAAAAATT GAAACTTTTT TTAAAGTAAC TAGCAAAATA
CCCATAAGTT GTTATGGAAT TTAGAAAACC ACATCGGCAC ATTGAAAAAA TAATATATTT TGAATTTAGA GCTTAATTTT
AGAATTAAAT TAGATGTTTT TTATAATATT ATATTTTTGG GGTAAAAAGG TGTAAACGGA TTCGATTGAT TTGTCATGAC
TGCGTAACTC CCTCCCTCAA AAAATTGCAT ATTTGATTTT GAGAGGTATG AACACGCGTA GATCCCTCAT ATCATAGTTT
TAAAGAGTTA AGTGATAGTA GATTCACCAC CATCCCTACT CTCTTCTCGA TAGTTATAGA TACTTAGATT CACTATCAGC
AAAGAATTCA GATGGAACTA AGGccccttt gattcaaaga aaattcatag aaattttaga ggattttatt cctataggaa
tttttccctg caaagccttt tgaattaaag gaatgaaccc tacgaaatcc tatgaaattc ctatagaatg cctcttccta
tacaagtttt gaaggaaatt tagggcccct ttgaatcgca gggttgaaaa aaatggagga ataggaaaaa cacatcattc
tgatagaaat gtaagtgtaa aacggaggat tgcaaaacac aggaaaaaca taggaatgac cgtttgattg gaccacagga
aaaacacagg aatttgagga gagataaaga ctcaaaggat ttcttccatg aggttctacc tcttgttaaa atttctccaa
aacttgtatg ggaagatgca ttccatagaa atttcatagg attccatagg gtacaatcat ttgattcaaa gggctttgta
ggaaaaattc ctataggaat gaaatcctct aaaattccta taaatttcct ttgaatcaaa gggggcctta acaagaggta
gaaccttatg gaaaaaaaat catttgagtc tttatctctc attaaattcc tgtgtttttc ctgtggtcca atcaaacggt
tattcctatg tttttcctgt tatatgcaat cctctgtttt acacttatat ttttgtcaga atcttagggc ccctttgaat
cgtagaattg aaaaaacgga ggaataggaa aaatatagga ttctgataag aatgcaagta taaaacagag gattgcaaaa
cacaggaaaa acacaggaat ggccgtttga ttggaccaca ggaaaaacgc aggattcaga tgagagagat agactcaagg
gaagttttcc aagaagttgg agtggatgtt aaatttccta cgtttttcct ctagaatcgt aggaaaagga aagtttccta
cgtttttcct tttctcattc ctacaaatca aaggtatgaa tagtgtagga tttcaattcc tttgtttttc ctccatttat
cctacaattc aaatggggcc Ttatgttttt tctattcctc tgttttttta ttcatgtgat tcagagaggc cctaaatgca
ttTGTACTGT GCAGATTTGG CAGCACTGGA ACAGGGGAAC ACTTCTAGAG CTGGTGGATC CGTCGACACT GACCAGAGCT
GGCCATGGCA CCACCAACCA GTGCTCTCTC CAGGCTGACC AGATGCTGGG GTGCATCCAT GTCGGCCTAC TCTGCGTGCA
GGCGAACCCC GCCGACCGCC CGAAGCTGTC GGCGGTGACC ACGATGATCG GCGGCACGGC GTCGCTCAAC CCTCCGTCGA
GGCCGGCGTT CTGGGTACTC CCGGAGGAGG ATGCGACGCG GGCAGCCGGC ACCAATTCTT CGCCAGGCGG CAGGGTGATG
GCCGCGTCGG CCAACCGTGT CTCCATCACC GAAATCGAGC CAAGATAGGT 

Locus: Os11g0549300

Loading...

Locus: Os11g0549300

Loading...