Os11t0557500-00

Locus

Os11g0557500

Description

Protein kinase, core domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLysM-RLK7, OsLYK6

Oryzabase Gene Name Synonym(s)

LysM receptor-like kinase 7, LysM-type receptor-like kinase6

Transcript Evidence

ab initio prediction

Protein Evidence

NP_001176606.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: cell wall macromolecule catabolic process (GO:0016998)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

Peptidoglycan-binding lysin domain (IPR018392)

Expression Databases

TENOR (Os11t0557500-00)

Others

Oryzabase (10926)

Transcript

2055 bp

>Os11t0557500-00 Protein kinase, core domain containing protein.
ATGGCGCAATCGCGTTCACACGCCATGGCCGCGTTCGCCTTCGTCGTCGTCTTCCTCCTC
TCCGGCGCGCCGGGAGCCCGGTCGCAGCAGCCGTACGGCTCGCAGGTGGCCGACTGCCCC
AACAAGCACAACGACACCGGCCTCCTGGGCTACTTCTGCAGCAGCGGCGGCGGCGGCGGC
GGCGCGCCGTCGTCGTCGTCGTCGTCGTGCCAGACCTACCTCACCTTCCACGCCACGCCG
CGCTACCCCGACCTCGCCGCCATCGCGTCGCTCCTCGGCGCCGACGCGTCCAGCCTCGCC
GCCGCGAACTCCGCGGCGTTGCCCACCGCGGCGCTCGCGCCGGGCGCCAAGGTGCTCGTC
CCGGCGACCTGCTCCTGCACGGGCGCCGCCTACTACCAGCGGAACGCGACGTACGTGGCG
GTCGCCGGCGACACGCTGCTGGTGATCGCGAACGACACGTTCCAGGGCCTGTCCACGTGC
CAGGCGGTGCAGGAGCAGGCCCTCGGCGACGCGCCGGCGAGGTCGCTCCTGGCGGGGCAG
CGCGTCACCGTGCCGCTCCGGTGCGCGTGCCCGAGCGCCGCCCAGGCCGCCGCCGGCGTG
AGGTACCTGGTGACGTACCTGGTCGACGAGTTCGACGAGGTGGGCGCCATCGCTGCGAGG
TTCGGCGTCGACGCCGGGAACATCTCGGCGGCCAACGAGATGGCCATTACTGACACCATA
TACCCTTTCACAACGCTGCTCATCCCCGTCAAGTCCAAGCCCGACGTGTCGCAGCTCCGG
TCGCCGCCGCCGCCGCCTCCTCCGCCGCCGGCGGCGCCTGCTCCGACCACGAACCGCAAG
AACCACACCGGAGTCTACGTCGGCATCGGTGCGGCCGCCGTGGCTGTTCTCGCCGTGGTC
ACCGCCGTTGTGGCTGCCCTTGCTGTGAGGGCGAGGAGGCAGCGACGGCGAGCCACCGCC
GCTGTCGCCGCCGCCGGAGGCAAGGGCGGTAAAGGCAACGACAAGGCGTCGCCGGCGTTC
ACCGGCGGCGAGGTGTCCGTGTCGATCAGCGAGGCGTTCTCGGGCCTCTCCGACATCAAG
TCCTCCCTGAAGGTGTTCACCTACGCGGAGCTCGCGGCGGCGACCGACGGCTTCAGCCCG
GACCGCCGCGTCGGCGGGTCGGTGTACCGCGCCGTGTTCAACGGCGACGCGGCCGCCGTG
GAGGTCGTGGACCGGGACGTGTCGGCGGAGGTGGAGATCATGAGGAAGATCAACCACCTC
AACCTTGTCAGGCTCATCGGCCTCTGCCACCACCGCGGCCGGTGGTACCTCGTCTCGGAG
TACGCCGAGCACGGCACGCTCCGCGACCGCCTCCTCGCCGGCGGCGGCGCGCCGCCGCTG
AGCTGGTCGCAGCGCGTGCAGGTGGCCCTCGACGTCGCCGAGGGGCTCCGCTACCTGCAC
GGGTACACGCGGCCGCCGTACGTGCACATGGACGTCAGCAGCGACAGCGTCCTCCTCGCC
GGCGGCGCCGACCTCCGCGGCAAGCTCCGCAACTTCGGCGGCGCCAGGGTCATCCGCGGC
GGCGGCGGCGAGGCGTTCACGATGACGAGCAACATCGCCGGGACGCGCGGGTACACGGCG
CCGGAGTACCTGGAGCACGGCGTCGTGTCGCCCAAGGCCGACGTGTACTCCCTCGGCGTC
GTGCTCCTGGAGCTCGtcaccggcaagggcgtcgacgagctggaggccgacggcgccggc
gacccgttcgccggcatgaacgcgctggccggagacctcgacggcggcagcgaagacgac
gcggcggtgacgaggagaatggaggagttcttggacccggcgatggcggcgaccgggagc
agctgcccgcgcgaggccgtggcgatgatggtgaagctgatcgagaggtgcgtccgccgc
gacgcggcggcgcggccgggaatgggggaggtggcgcagcatctgctgatgttgcacggc
gtctccggcgacggctggcacagctcgctggagcactaccggagctccggcggcgacggc
ggCGAACAGCCATAG

CDS

2055 bp

>Os11t0557500-00 Protein kinase, core domain containing protein.
ATGGCGCAATCGCGTTCACACGCCATGGCCGCGTTCGCCTTCGTCGTCGTCTTCCTCCTC
TCCGGCGCGCCGGGAGCCCGGTCGCAGCAGCCGTACGGCTCGCAGGTGGCCGACTGCCCC
AACAAGCACAACGACACCGGCCTCCTGGGCTACTTCTGCAGCAGCGGCGGCGGCGGCGGC
GGCGCGCCGTCGTCGTCGTCGTCGTCGTGCCAGACCTACCTCACCTTCCACGCCACGCCG
CGCTACCCCGACCTCGCCGCCATCGCGTCGCTCCTCGGCGCCGACGCGTCCAGCCTCGCC
GCCGCGAACTCCGCGGCGTTGCCCACCGCGGCGCTCGCGCCGGGCGCCAAGGTGCTCGTC
CCGGCGACCTGCTCCTGCACGGGCGCCGCCTACTACCAGCGGAACGCGACGTACGTGGCG
GTCGCCGGCGACACGCTGCTGGTGATCGCGAACGACACGTTCCAGGGCCTGTCCACGTGC
CAGGCGGTGCAGGAGCAGGCCCTCGGCGACGCGCCGGCGAGGTCGCTCCTGGCGGGGCAG
CGCGTCACCGTGCCGCTCCGGTGCGCGTGCCCGAGCGCCGCCCAGGCCGCCGCCGGCGTG
AGGTACCTGGTGACGTACCTGGTCGACGAGTTCGACGAGGTGGGCGCCATCGCTGCGAGG
TTCGGCGTCGACGCCGGGAACATCTCGGCGGCCAACGAGATGGCCATTACTGACACCATA
TACCCTTTCACAACGCTGCTCATCCCCGTCAAGTCCAAGCCCGACGTGTCGCAGCTCCGG
TCGCCGCCGCCGCCGCCTCCTCCGCCGCCGGCGGCGCCTGCTCCGACCACGAACCGCAAG
AACCACACCGGAGTCTACGTCGGCATCGGTGCGGCCGCCGTGGCTGTTCTCGCCGTGGTC
ACCGCCGTTGTGGCTGCCCTTGCTGTGAGGGCGAGGAGGCAGCGACGGCGAGCCACCGCC
GCTGTCGCCGCCGCCGGAGGCAAGGGCGGTAAAGGCAACGACAAGGCGTCGCCGGCGTTC
ACCGGCGGCGAGGTGTCCGTGTCGATCAGCGAGGCGTTCTCGGGCCTCTCCGACATCAAG
TCCTCCCTGAAGGTGTTCACCTACGCGGAGCTCGCGGCGGCGACCGACGGCTTCAGCCCG
GACCGCCGCGTCGGCGGGTCGGTGTACCGCGCCGTGTTCAACGGCGACGCGGCCGCCGTG
GAGGTCGTGGACCGGGACGTGTCGGCGGAGGTGGAGATCATGAGGAAGATCAACCACCTC
AACCTTGTCAGGCTCATCGGCCTCTGCCACCACCGCGGCCGGTGGTACCTCGTCTCGGAG
TACGCCGAGCACGGCACGCTCCGCGACCGCCTCCTCGCCGGCGGCGGCGCGCCGCCGCTG
AGCTGGTCGCAGCGCGTGCAGGTGGCCCTCGACGTCGCCGAGGGGCTCCGCTACCTGCAC
GGGTACACGCGGCCGCCGTACGTGCACATGGACGTCAGCAGCGACAGCGTCCTCCTCGCC
GGCGGCGCCGACCTCCGCGGCAAGCTCCGCAACTTCGGCGGCGCCAGGGTCATCCGCGGC
GGCGGCGGCGAGGCGTTCACGATGACGAGCAACATCGCCGGGACGCGCGGGTACACGGCG
CCGGAGTACCTGGAGCACGGCGTCGTGTCGCCCAAGGCCGACGTGTACTCCCTCGGCGTC
GTGCTCCTGGAGCTCGtcaccggcaagggcgtcgacgagctggaggccgacggcgccggc
gacccgttcgccggcatgaacgcgctggccggagacctcgacggcggcagcgaagacgac
gcggcggtgacgaggagaatggaggagttcttggacccggcgatggcggcgaccgggagc
agctgcccgcgcgaggccgtggcgatgatggtgaagctgatcgagaggtgcgtccgccgc
gacgcggcggcgcggccgggaatgggggaggtggcgcagcatctgctgatgttgcacggc
gtctccggcgacggctggcacagctcgctggagcactaccggagctccggcggcgacggc
ggCGAACAGCCATAG

Protein

685 aa

>Os11t0557500-00 Protein kinase, core domain containing protein.
MAQSRSHAMAAFAFVVVFLLSGAPGARSQQPYGSQVADCPNKHNDTGLLGYFCSSGGGGG
GAPSSSSSSCQTYLTFHATPRYPDLAAIASLLGADASSLAAANSAALPTAALAPGAKVLV
PATCSCTGAAYYQRNATYVAVAGDTLLVIANDTFQGLSTCQAVQEQALGDAPARSLLAGQ
RVTVPLRCACPSAAQAAAGVRYLVTYLVDEFDEVGAIAARFGVDAGNISAANEMAITDTI
YPFTTLLIPVKSKPDVSQLRSPPPPPPPPPAAPAPTTNRKNHTGVYVGIGAAAVAVLAVV
TAVVAALAVRARRQRRRATAAVAAAGGKGGKGNDKASPAFTGGEVSVSISEAFSGLSDIK
SSLKVFTYAELAAATDGFSPDRRVGGSVYRAVFNGDAAAVEVVDRDVSAEVEIMRKINHL
NLVRLIGLCHHRGRWYLVSEYAEHGTLRDRLLAGGGAPPLSWSQRVQVALDVAEGLRYLH
GYTRPPYVHMDVSSDSVLLAGGADLRGKLRNFGGARVIRGGGGEAFTMTSNIAGTRGYTA
PEYLEHGVVSPKADVYSLGVVLLELVTGKGVDELEADGAGDPFAGMNALAGDLDGGSEDD
AAVTRRMEEFLDPAMAATGSSCPREAVAMMVKLIERCVRRDAAARPGMGEVAQHLLMLHG
VSGDGWHSSLEHYRSSGGDGGEQP*

CDS

chr11:20716456..20718510 (+ strand) : 2055 bp

FASTA

>Os11t0557500-00 class=Sequence position=chr11:20716456..20718510 (+ strand)
ATGGCGCAAT CGCGTTCACA CGCCATGGCC GCGTTCGCCT TCGTCGTCGT CTTCCTCCTC TCCGGCGCGC CGGGAGCCCG
GTCGCAGCAG CCGTACGGCT CGCAGGTGGC CGACTGCCCC AACAAGCACA ACGACACCGG CCTCCTGGGC TACTTCTGCA
GCAGCGGCGG CGGCGGCGGC GGCGCGCCGT CGTCGTCGTC GTCGTCGTGC CAGACCTACC TCACCTTCCA CGCCACGCCG
CGCTACCCCG ACCTCGCCGC CATCGCGTCG CTCCTCGGCG CCGACGCGTC CAGCCTCGCC GCCGCGAACT CCGCGGCGTT
GCCCACCGCG GCGCTCGCGC CGGGCGCCAA GGTGCTCGTC CCGGCGACCT GCTCCTGCAC GGGCGCCGCC TACTACCAGC
GGAACGCGAC GTACGTGGCG GTCGCCGGCG ACACGCTGCT GGTGATCGCG AACGACACGT TCCAGGGCCT GTCCACGTGC
CAGGCGGTGC AGGAGCAGGC CCTCGGCGAC GCGCCGGCGA GGTCGCTCCT GGCGGGGCAG CGCGTCACCG TGCCGCTCCG
GTGCGCGTGC CCGAGCGCCG CCCAGGCCGC CGCCGGCGTG AGGTACCTGG TGACGTACCT GGTCGACGAG TTCGACGAGG
TGGGCGCCAT CGCTGCGAGG TTCGGCGTCG ACGCCGGGAA CATCTCGGCG GCCAACGAGA TGGCCATTAC TGACACCATA
TACCCTTTCA CAACGCTGCT CATCCCCGTC AAGTCCAAGC CCGACGTGTC GCAGCTCCGG TCGCCGCCGC CGCCGCCTCC
TCCGCCGCCG GCGGCGCCTG CTCCGACCAC GAACCGCAAG AACCACACCG GAGTCTACGT CGGCATCGGT GCGGCCGCCG
TGGCTGTTCT CGCCGTGGTC ACCGCCGTTG TGGCTGCCCT TGCTGTGAGG GCGAGGAGGC AGCGACGGCG AGCCACCGCC
GCTGTCGCCG CCGCCGGAGG CAAGGGCGGT AAAGGCAACG ACAAGGCGTC GCCGGCGTTC ACCGGCGGCG AGGTGTCCGT
GTCGATCAGC GAGGCGTTCT CGGGCCTCTC CGACATCAAG TCCTCCCTGA AGGTGTTCAC CTACGCGGAG CTCGCGGCGG
CGACCGACGG CTTCAGCCCG GACCGCCGCG TCGGCGGGTC GGTGTACCGC GCCGTGTTCA ACGGCGACGC GGCCGCCGTG
GAGGTCGTGG ACCGGGACGT GTCGGCGGAG GTGGAGATCA TGAGGAAGAT CAACCACCTC AACCTTGTCA GGCTCATCGG
CCTCTGCCAC CACCGCGGCC GGTGGTACCT CGTCTCGGAG TACGCCGAGC ACGGCACGCT CCGCGACCGC CTCCTCGCCG
GCGGCGGCGC GCCGCCGCTG AGCTGGTCGC AGCGCGTGCA GGTGGCCCTC GACGTCGCCG AGGGGCTCCG CTACCTGCAC
GGGTACACGC GGCCGCCGTA CGTGCACATG GACGTCAGCA GCGACAGCGT CCTCCTCGCC GGCGGCGCCG ACCTCCGCGG
CAAGCTCCGC AACTTCGGCG GCGCCAGGGT CATCCGCGGC GGCGGCGGCG AGGCGTTCAC GATGACGAGC AACATCGCCG
GGACGCGCGG GTACACGGCG CCGGAGTACC TGGAGCACGG CGTCGTGTCG CCCAAGGCCG ACGTGTACTC CCTCGGCGTC
GTGCTCCTGG AGCTCGtcac cggcaagggc gtcgacgagc tggaggccga cggcgccggc gacccgttcg ccggcatgaa
cgcgctggcc ggagacctcg acggcggcag cgaagacgac gcggcggtga cgaggagaat ggaggagttc ttggacccgg
cgatggcggc gaccgggagc agctgcccgc gcgaggccgt ggcgatgatg gtgaagctga tcgagaggtg cgtccgccgc
gacgcggcgg cgcggccggg aatgggggag gtggcgcagc atctgctgat gttgcacggc gtctccggcg acggctggca
cagctcgctg gagcactacc ggagctccgg cggcgacggc ggCGAACAGC CATAG

Locus: Os11g0557500

Loading...

Locus: Os11g0557500

Loading...