Os11t0558200-01

Locus

Os11g0558200

Description

R2R3-type MYB transcriptional activator, Tolerance to Pi deficiency

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

R2R3-MYB, OsMYB4P

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

R2R3-MYB, OsMYB4P

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK110844

Protein Evidence

Q2R2L6

Literature

PMID: 24813725

Note

Manual Curation

May 28, 2015

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Homeodomain-like (IPR009057)

SANT/Myb domain (IPR001005)

Myb domain (IPR017930)

Full-length cDNA

002-172-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0558200-01)

RiceXPro (AK110844)

Others

Oryzabase (16305)

KEGG (Os11t0558200-01)

Transcript

1464 bp

>Os11t0558200-01 R2R3-type MYB transcriptional activator, Tolerance to Pi deficiency
AGTTTCAGTTTCAGAGAGAGGAGTCAGTGGCTGTATGCTGCCATGGCTCTCAAGGTGGCT
AGATAGACAGACATGTTGCCCATCAACTTAAGAAGCAACTAGCTGCTGCTGCTGCTAAGG
GAGAGCTATAGGCTTAGCTGTGGTAGGCTATAGATATTACTATTAGGTAGCTACTAGCCT
ATAGGCAGACATGGGGAGACCTCCATGCTGCGACAATGGCGTCGGCGTCAAGAAAGGGCC
ATGGACGCCAGAGGAGGACATCATCCTCGTCTCCTACATCCAGCAGCATGGCCCCGGGAA
CTGGCGCTCCGTGCCCGAGAACACCGgattgatgaggtgcagcaagagctgcaggctgcg
gtggacgaactacttgagaccggggatcaagcgtggcaacttcacccctcatgaggaggg
gatcatcatccacctccaggcattgcttggcaacaaGTGGGCAGCAATAGCCTCCTACCT
CCCCCAAAgaacagacaacgacatcaagaactactggaacacacACCTCAAGAAGAAGGT
GAAGAGGCTGCAACAACAACAACAATCACACCCTGATCATCATCACCACCATTCCTTCCA
AACCACCCCTTCTTCCTCCAATGCAGCAGCAGTAGCAACAACCAGCCCAAACTACTACAA
CCCTAACAACAGCAACAGCAACAGCAGCAATTACCTCCATAACAACAACCACAATCTTGA
ATCCATGCAATCCATGGCCACTGCACCTAGCAATGAGGCCACCACCATCCCCAAGCTCTT
CCAGTTCCAGACATGGATGAAGCCATCACCAGCAACAACATCATCAGCAGCAACAGCTGC
TGCAGGTAGCTGCTACAAGCAGGCCATGGCCATGCAGGAGCTCCAAGAGGAGCAAGAGGG
CTCTGCTGCTGCTGCTGCAATGGCTTCTTCCATTGATGGCGTCTCCAAGGACCAGGATTA
TCACATGTGTGCTGTGATCAGTGGTGATGACAAGTCGTCGTCGTCGGAGATGATGACGGC
TGCGGCAATGGCCGGCCATGGCGAGGCGGCCACGACGACCTTCTCGCTGCTCGAGAACTG
GCTGCTCGACGACATGCCGGGGCAGGCGGCCATGAGCGCCGCCATGGATGGGTTCTTGGA
GATCTCTGCTGGATACTGCTGTGCAGACCCTATCATGTTCTGAACTTTCTGAACTTCTGA
TGATCATCTCAGCCTTAATTTCCCATATGAGTCTCTCTTTGCTATAGGTTTCTTAATTTC
ACTGAGTTAATTTGCACTTGTACTAGCTGTTTGATGCTCTCTCTCTCTCGATGATCTTGT
GTTTCCGGTAATAAACCGTTGGTTTAATTTCCTCAAGAAAAAGCAATCCACCTGGAAATA
ATCTGGTTGGTTTGGAGAAATATTGTCAGTTCTCAAGGATGTAATAAAAGGATTAAAGCT
GCCATAATTCGTTGCCTGATATGC

CDS

993 bp

>Os11t0558200-01 R2R3-type MYB transcriptional activator, Tolerance to Pi deficiency
ATGGGGAGACCTCCATGCTGCGACAATGGCGTCGGCGTCAAGAAAGGGCCATGGACGCCA
GAGGAGGACATCATCCTCGTCTCCTACATCCAGCAGCATGGCCCCGGGAACTGGCGCTCC
GTGCCCGAGAACACCGgattgatgaggtgcagcaagagctgcaggctgcggtggacgaac
tacttgagaccggggatcaagcgtggcaacttcacccctcatgaggaggggatcatcatc
cacctccaggcattgcttggcaacaaGTGGGCAGCAATAGCCTCCTACCTCCCCCAAAga
acagacaacgacatcaagaactactggaacacacACCTCAAGAAGAAGGTGAAGAGGCTG
CAACAACAACAACAATCACACCCTGATCATCATCACCACCATTCCTTCCAAACCACCCCT
TCTTCCTCCAATGCAGCAGCAGTAGCAACAACCAGCCCAAACTACTACAACCCTAACAAC
AGCAACAGCAACAGCAGCAATTACCTCCATAACAACAACCACAATCTTGAATCCATGCAA
TCCATGGCCACTGCACCTAGCAATGAGGCCACCACCATCCCCAAGCTCTTCCAGTTCCAG
ACATGGATGAAGCCATCACCAGCAACAACATCATCAGCAGCAACAGCTGCTGCAGGTAGC
TGCTACAAGCAGGCCATGGCCATGCAGGAGCTCCAAGAGGAGCAAGAGGGCTCTGCTGCT
GCTGCTGCAATGGCTTCTTCCATTGATGGCGTCTCCAAGGACCAGGATTATCACATGTGT
GCTGTGATCAGTGGTGATGACAAGTCGTCGTCGTCGGAGATGATGACGGCTGCGGCAATG
GCCGGCCATGGCGAGGCGGCCACGACGACCTTCTCGCTGCTCGAGAACTGGCTGCTCGAC
GACATGCCGGGGCAGGCGGCCATGAGCGCCGCCATGGATGGGTTCTTGGAGATCTCTGCT
GGATACTGCTGTGCAGACCCTATCATGTTCTGA

Protein

331 aa

>Os11t0558200-01 R2R3-type MYB transcriptional activator, Tolerance to Pi deficiency
MGRPPCCDNGVGVKKGPWTPEEDIILVSYIQQHGPGNWRSVPENTGLMRCSKSCRLRWTN
YLRPGIKRGNFTPHEEGIIIHLQALLGNKWAAIASYLPQRTDNDIKNYWNTHLKKKVKRL
QQQQQSHPDHHHHHSFQTTPSSSNAAAVATTSPNYYNPNNSNSNSSNYLHNNNHNLESMQ
SMATAPSNEATTIPKLFQFQTWMKPSPATTSSAATAAAGSCYKQAMAMQELQEEQEGSAA
AAAMASSIDGVSKDQDYHMCAVISGDDKSSSSEMMTAAAMAGHGEAATTTFSLLENWLLD
DMPGQAAMSAAMDGFLEISAGYCCADPIMF*

5'UTR

chr11:20737489..20737678 (- strand) : 190 bp

CDS

chr11:20737353..20737488 (- strand) : 136 bp

chr11:20737042..20737171 (- strand) : 130 bp

chr11:20735398..20736124 (- strand) : 727 bp

3'UTR

chr11:20735117..20735397 (- strand) : 281 bp

FASTA

>Os11t0558200-01 class=Sequence position=chr11:20735117..20737678 (- strand)
AGTTTCAGTT TCAGAGAGAG GAGTCAGTGG CTGTATGCTG CCATGGCTCT CAAGGTGGCT AGATAGACAG ACATGTTGCC
CATCAACTTA AGAAGCAACT AGCTGCTGCT GCTGCTAAGG GAGAGCTATA GGCTTAGCTG TGGTAGGCTA TAGATATTAC
TATTAGGTAG CTACTAGCCT ATAGGCAGAC ATGGGGAGAC CTCCATGCTG CGACAATGGC GTCGGCGTCA AGAAAGGGCC
ATGGACGCCA GAGGAGGACA TCATCCTCGT CTCCTACATC CAGCAGCATG GCCCCGGGAA CTGGCGCTCC GTGCCCGAGA
ACACCGGTTA GCCCCCCCCC CCTCCCCCTG GCTCTCGCGT TTTCGATCCA TTCGTCGTCG AATGATCGAT ATTGCATGTG
TTTGATTTTT GCATGGTTGA TATCAGAAGC TGTTTTAGTT ATGCTTCTGT TGTTGTTTAG GAGTTGATGA TAAGTTTGTT
TCTGTTGTGT TTTTTgtatg tgtttaggat tgatgaggtg cagcaagagc tgcaggctgc ggtggacgaa ctacttgaga
ccggggatca agcgtggcaa cttcacccct catgaggagg ggatcatcat ccacctccag gcattgcttg gcaacaagtA
ATCACGTACA TAACTCAATT TAAATAAATT GTTGTATCAT ATACATGAGC ATCAAAATCT AATGGGATGT TTTTAGTTTA
TTTTCTATCC TTGAAGAGAT ATATATACAT CCGTACCACT CCGAGATAAA AAAAACTGTA AATCAATTGA ACTGATTAGA
ATTGACATTG TTAGAATTTT CCTGGTTCTT GGGATGAATA AAATGTTTAC TTTTATATGT GAATCTAGAT GTAGATTATG
TCCAGATTCA TTTAAAAAAT AGACTTATTT TATAACGGAG GGAGCATATA ACCTCATAGT TTTACACGTA AGGTACATAC
CTCCTAACTA ATACTCATAC CTCTTAAAGA TTGAAGAAAA CGCCAACAAA TATATAGGTG AACTCCCAAT CCTACTCTCA
TTTGTTATGA TATTGGTTTT GGTACATCAC TTCACAGATC TTATATACCT CTGAACTCTA GTCCAAGAAT GAAAGAAAAC
CTCTATGCAC TCCTATATAT TGTTTATAGT TTAAGCTTAG TTTTATGATA ACTCAAGCAA ACCCTGACTT TCTGATGATC
ATCTGAACTT TTTCAAAATC ATATTGTCTT TACCTTAATC ATGCTTTACC TTTTGCATAT ATTACATGAC AGGTTATAAC
ATACGccctc cgtcccaaaa aactcaactt ctagagattg aattttgtct aaaaaaaaca acttctatca tcctacctac
tctcagtacg taaaacgaga agttttatcc cttcaatacc ctttacctat ctatctctct tactactttt tttcaatgat
tatgggtatt ttagtcaatc ttcatctcca ctatttttgt cttgggatgt taggattgac atttttatgg gacggagaga
gTAGTGCCTA AATATTTATC TATTGTGCAT GCAGGTGGGC AGCAATAGCC TCCTACCTCC CCCAAAgaac agacaacgac
atcaagaact actggaacac acACCTCAAG AAGAAGGTGA AGAGGCTGCA ACAACAACAA CAATCACACC CTGATCATCA
TCACCACCAT TCCTTCCAAA CCACCCCTTC TTCCTCCAAT GCAGCAGCAG TAGCAACAAC CAGCCCAAAC TACTACAACC
CTAACAACAG CAACAGCAAC AGCAGCAATT ACCTCCATAA CAACAACCAC AATCTTGAAT CCATGCAATC CATGGCCACT
GCACCTAGCA ATGAGGCCAC CACCATCCCC AAGCTCTTCC AGTTCCAGAC ATGGATGAAG CCATCACCAG CAACAACATC
ATCAGCAGCA ACAGCTGCTG CAGGTAGCTG CTACAAGCAG GCCATGGCCA TGCAGGAGCT CCAAGAGGAG CAAGAGGGCT
CTGCTGCTGC TGCTGCAATG GCTTCTTCCA TTGATGGCGT CTCCAAGGAC CAGGATTATC ACATGTGTGC TGTGATCAGT
GGTGATGACA AGTCGTCGTC GTCGGAGATG ATGACGGCTG CGGCAATGGC CGGCCATGGC GAGGCGGCCA CGACGACCTT
CTCGCTGCTC GAGAACTGGC TGCTCGACGA CATGCCGGGG CAGGCGGCCA TGAGCGCCGC CATGGATGGG TTCTTGGAGA
TCTCTGCTGG ATACTGCTGT GCAGACCCTA TCATGTTCTG AACTTTCTGA ACTTCTGATG ATCATCTCAG CCTTAATTTC
CCATATGAGT CTCTCTTTGC TATAGGTTTC TTAATTTCAC TGAGTTAATT TGCACTTGTA CTAGCTGTTT GATGCTCTCT
CTCTCTCGAT GATCTTGTGT TTCCGGTAAT AAACCGTTGG TTTAATTTCC TCAAGAAAAA GCAATCCACC TGGAAATAAT
CTGGTTGGTT TGGAGAAATA TTGTCAGTTC TCAAGGATGT AATAAAAGGA TTAAAGCTGC CATAATTCGT TGCCTGATAT
GC

Locus: Os11g0558200

Loading...

Locus: Os11g0558200

Loading...