Os11t0559200-00

Locus

Os11g0559200

Description

Protein kinase, core domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

XA21

CGSNL Gene Name

XANTHOMONAS ORYZAE PV. ORYZAE RESISTANCE 21

Oryzabase Gene Symbol Synonym(s)

Xa21*, Xa21, OsXA21

Oryzabase Gene Name Synonym(s)

Xanthomonas oryzae pv. oryzae resistance 21, Xanthomonas campestris pv. oryzae resistance-21, Xanthomonas oryzae pv. oryzae resistance-21, Xanthomonas resistance 21

Transcript Evidence

ab initio prediction

Protein Evidence

O24436 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Leucine-rich repeat (IPR001611)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Leucine-rich repeat-containing N-terminal, type 2 (IPR013210)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Expression Databases

TENOR (Os11t0559200-00)

Others

Oryzabase (935)

KEGG (Os11t0559200-00)

Transcript

2997 bp

>Os11t0559200-00 Protein kinase, core domain containing protein.
ATGATATCACTCCCATTACTGCTCTTCGTCCTCTTCTTCTCTGCGCTGCTGCTCTTCCCT
TCGAGCAGTGACGACGACGGTGGTGGTGATGCTGCCGGCGACGAACTCGCGCTGCTCTCT
TTCAAGTCATCCCTGCTATACCAGGGGGGCCAGTCGCTGGCATCTTGGAACACGTCCGGC
CATGGCCAGCACTGCACATGGGTGGGTGTCGTGTGCGGCCGCCGGCACCCACACAGGGTG
GTGAAGCTGCGGCTGCGCTCCTCCAACCTGGCCGGGATCATCTCGCCGTCGCTGGGCAAC
CTATCCTTCCTCAGGACGCTGCAACTCAGCGACAACCACCTGTCCGGCAAGATACCCCAG
GAGCTCAGCCGTCTCATCAGGCTCCAGCAACTGGTACTGAATTTCAACAGCCTATCGGGT
GAGATTCCAGCTGCTTTGGGCAATCTAACCAGTCTCTCGGTTCTTGAGCTGACTAACAAT
ACACTGTCCGGAGCAATCCCTTCATCTCTGGGCAAACTCACAGGTCTCACTGATCTTGCA
CTGGCTGAAAATACGCTGTCTGGTTCCATCCCATCATCTTTCGGCCAATTGCGCAGATTA
TCTTTCCTTAGCTTAGCCTTTAACAATTTAAGTGGAGCGATCCCAGATCCTATTTGGAAC
ATCTCCTCTCTCACCATATTCGAAGTCATATCCAACAAGCTAAGTGGTACACTGCCTACA
AATGCATTCAGTAATCTTCCTAGTCTGCAGGAGGTATACATGTATTACAACCAGTTTCAT
GGTCGTATCCCGGCATCGATAGGTAATGCTTCCAACATCTCAATATTTACCATTGGTTTA
AACTCTTTTAGCGGTGTTGTTCCACCGGAGATTGGAAGGATGAGAAATCTTCAGAGACTA
GAGCTTCCAGAAACTCTTTTGGAAGCTAAAGAAACAAATGATTGGAAATTCATGACGGCA
TTGACAAATTGCTCCAATCTTCAAGAAGTGGAACTGGGAGGTTGTAAATTTGGTGGAGTC
CTCCCTGATTCTGTTTCCAATCTTTCCTCTTCGCTTGTATCTCTCTCCATTAGAGATAAC
AAAATTTCAGGGAGCTTACCTAGAGATATCGGTAATCTCGTTAATTTACAATATCTTTCT
CTCGCTAACAACTCCTTGACAGGATCCCTTCCCTCTTCCTTCAGCAAGCTTAAAAATTTA
CGTCGTCTCACTGTAGATAACAACAAGTTAATTGGTTCTCTCCCATTCACCATCGGTAAT
CTTACACAACTAACTAATATGGAGGTCCAATTTAATGCCTTCGGTGGTACAATACCAAGC
ACACTTGGAAACCTGACCAAGCTGTTTCAAATAAATCTTGGCCACAATAACTTTATAGGG
CAAATTCCCATTGAAATATTTAGCATTCCCGCACTCTCTGAAATTTTGGATGTGTCCCAT
CATAACTTGGAGGGATCAATACCAAAAGAAATAGGGAAACTTAAAAATATTGTCGAATTC
CATGCTGATTCGAACAAATTATCGGGTGAGATCCCTAGCACCATTGGTGAATGCCAACTT
CTGCAGCATCTTTTCCTGCAAAACAATTTCTTAAATGGTAGCATCCCAATAGCTCTGACT
CAGTTGAAAGGTCTGGACACACTTGATCTCTCAGGTAACAATTTGTCAGGTCAGATACCT
ATGTCCTTAGGGGACATGCCTCTGCTCCACTCGCTGAACCTTTCGTTCAACAGCTTCCAC
GGTGAAGTGCCAACCAATGGTGTTTTTGCAAATGCTTCTGAAATTTACATCCAAGGCAAT
GCCCATATTTGCGGTGGCATACCTGAACTACATCTTCCGACGTGTTCCTTAAAATCAAGA
AAGAAAAAGAAACATCAAATTCTGCTGTTAGTGGTTGTTATCTGTCTCGTTTCGACACTT
GCCGTCTTTTCGTTACTCTACATGCTTCTAACCTGTCATAAGAGAAGAAAGAAAGAAGTC
CCTGCAACGACATCCATGCAAGGCCACCCAATGATCACTTACAAGCAGCTGGTAAAAGCA
ACGGATGGTTTTTCGTCCAGCCATTTGTTGGGTTCTGGATCTTTTGGCTCTGTTTACAAA
GGAGAATTTGATAGTCAAGATGGTGAAATCACAAGTCTTGTTGCCGTGAAGGTACTAAAG
CTGGAAACTCCAAAGGCACTCAAGAGTTTCACGTCCGAATGCGAAACACTGCGAAATACT
CGACACCGGAATCTTGTCAAGATAGTTACGATTTGCTCGAGCATCGATAACAGAGGGAAT
GATTTCAAAGCAATTGTGTATGACTTCATGCCCAATGGCAGTCTGGAAGATTGGCTACAC
CCTGAAACAAATGATCAAGCAGAGCAAAGGCACTTGACTCTGCATCAGAGAGTGACCATA
CTACTTGATGTTGCATGTGCATTGGACCATCTTCACTTCCATGGCCCTGAACCTATTGTA
CACTGTGATATTAAATCAAGCAATGTGTTGTTAGATGCTGATATGGTAGCCCATGTTGGA
GACTTTGGACTTGCAAGAATACTTATTGAGGGAAGCTCATTGATGCAACAGTCAACAAGT
TCGATGGGAATCAGGGGGACAATTGGTTACGCAGCACCAGAGTATGGTGTCGGGAACACT
GCCTCGACACATGGAGATATTTACAGTTATGGAATTCTAGTGTTGGAAACAGTAACCGGG
ATGCGGCCGGCAGATAGTACATTCAGAACTGGATTGAGCCTCCGTCAGTACGTTGAACCG
GGTCTACATGGTAGACTGATGGATGTTGTTGACAGGAAGCTTGGTTTGGATTCCGAGAAA
TGGCTTCAGGCTCGAGATGTTTCGCCATGCAGCAGTATTACTGAATGCCTTGTTTCACTG
CTTAGACTTGGGCTGTCTTGCTCTCAGGAATTGCCATCGAGTAGAACGCAAGCCGGAGAT
GTCATCAATGAACTGCGTGCCATCAAAGAGTCTCTCTCGATGTCATCCGACATGTGA

CDS

2997 bp

>Os11t0559200-00 Protein kinase, core domain containing protein.
ATGATATCACTCCCATTACTGCTCTTCGTCCTCTTCTTCTCTGCGCTGCTGCTCTTCCCT
TCGAGCAGTGACGACGACGGTGGTGGTGATGCTGCCGGCGACGAACTCGCGCTGCTCTCT
TTCAAGTCATCCCTGCTATACCAGGGGGGCCAGTCGCTGGCATCTTGGAACACGTCCGGC
CATGGCCAGCACTGCACATGGGTGGGTGTCGTGTGCGGCCGCCGGCACCCACACAGGGTG
GTGAAGCTGCGGCTGCGCTCCTCCAACCTGGCCGGGATCATCTCGCCGTCGCTGGGCAAC
CTATCCTTCCTCAGGACGCTGCAACTCAGCGACAACCACCTGTCCGGCAAGATACCCCAG
GAGCTCAGCCGTCTCATCAGGCTCCAGCAACTGGTACTGAATTTCAACAGCCTATCGGGT
GAGATTCCAGCTGCTTTGGGCAATCTAACCAGTCTCTCGGTTCTTGAGCTGACTAACAAT
ACACTGTCCGGAGCAATCCCTTCATCTCTGGGCAAACTCACAGGTCTCACTGATCTTGCA
CTGGCTGAAAATACGCTGTCTGGTTCCATCCCATCATCTTTCGGCCAATTGCGCAGATTA
TCTTTCCTTAGCTTAGCCTTTAACAATTTAAGTGGAGCGATCCCAGATCCTATTTGGAAC
ATCTCCTCTCTCACCATATTCGAAGTCATATCCAACAAGCTAAGTGGTACACTGCCTACA
AATGCATTCAGTAATCTTCCTAGTCTGCAGGAGGTATACATGTATTACAACCAGTTTCAT
GGTCGTATCCCGGCATCGATAGGTAATGCTTCCAACATCTCAATATTTACCATTGGTTTA
AACTCTTTTAGCGGTGTTGTTCCACCGGAGATTGGAAGGATGAGAAATCTTCAGAGACTA
GAGCTTCCAGAAACTCTTTTGGAAGCTAAAGAAACAAATGATTGGAAATTCATGACGGCA
TTGACAAATTGCTCCAATCTTCAAGAAGTGGAACTGGGAGGTTGTAAATTTGGTGGAGTC
CTCCCTGATTCTGTTTCCAATCTTTCCTCTTCGCTTGTATCTCTCTCCATTAGAGATAAC
AAAATTTCAGGGAGCTTACCTAGAGATATCGGTAATCTCGTTAATTTACAATATCTTTCT
CTCGCTAACAACTCCTTGACAGGATCCCTTCCCTCTTCCTTCAGCAAGCTTAAAAATTTA
CGTCGTCTCACTGTAGATAACAACAAGTTAATTGGTTCTCTCCCATTCACCATCGGTAAT
CTTACACAACTAACTAATATGGAGGTCCAATTTAATGCCTTCGGTGGTACAATACCAAGC
ACACTTGGAAACCTGACCAAGCTGTTTCAAATAAATCTTGGCCACAATAACTTTATAGGG
CAAATTCCCATTGAAATATTTAGCATTCCCGCACTCTCTGAAATTTTGGATGTGTCCCAT
CATAACTTGGAGGGATCAATACCAAAAGAAATAGGGAAACTTAAAAATATTGTCGAATTC
CATGCTGATTCGAACAAATTATCGGGTGAGATCCCTAGCACCATTGGTGAATGCCAACTT
CTGCAGCATCTTTTCCTGCAAAACAATTTCTTAAATGGTAGCATCCCAATAGCTCTGACT
CAGTTGAAAGGTCTGGACACACTTGATCTCTCAGGTAACAATTTGTCAGGTCAGATACCT
ATGTCCTTAGGGGACATGCCTCTGCTCCACTCGCTGAACCTTTCGTTCAACAGCTTCCAC
GGTGAAGTGCCAACCAATGGTGTTTTTGCAAATGCTTCTGAAATTTACATCCAAGGCAAT
GCCCATATTTGCGGTGGCATACCTGAACTACATCTTCCGACGTGTTCCTTAAAATCAAGA
AAGAAAAAGAAACATCAAATTCTGCTGTTAGTGGTTGTTATCTGTCTCGTTTCGACACTT
GCCGTCTTTTCGTTACTCTACATGCTTCTAACCTGTCATAAGAGAAGAAAGAAAGAAGTC
CCTGCAACGACATCCATGCAAGGCCACCCAATGATCACTTACAAGCAGCTGGTAAAAGCA
ACGGATGGTTTTTCGTCCAGCCATTTGTTGGGTTCTGGATCTTTTGGCTCTGTTTACAAA
GGAGAATTTGATAGTCAAGATGGTGAAATCACAAGTCTTGTTGCCGTGAAGGTACTAAAG
CTGGAAACTCCAAAGGCACTCAAGAGTTTCACGTCCGAATGCGAAACACTGCGAAATACT
CGACACCGGAATCTTGTCAAGATAGTTACGATTTGCTCGAGCATCGATAACAGAGGGAAT
GATTTCAAAGCAATTGTGTATGACTTCATGCCCAATGGCAGTCTGGAAGATTGGCTACAC
CCTGAAACAAATGATCAAGCAGAGCAAAGGCACTTGACTCTGCATCAGAGAGTGACCATA
CTACTTGATGTTGCATGTGCATTGGACCATCTTCACTTCCATGGCCCTGAACCTATTGTA
CACTGTGATATTAAATCAAGCAATGTGTTGTTAGATGCTGATATGGTAGCCCATGTTGGA
GACTTTGGACTTGCAAGAATACTTATTGAGGGAAGCTCATTGATGCAACAGTCAACAAGT
TCGATGGGAATCAGGGGGACAATTGGTTACGCAGCACCAGAGTATGGTGTCGGGAACACT
GCCTCGACACATGGAGATATTTACAGTTATGGAATTCTAGTGTTGGAAACAGTAACCGGG
ATGCGGCCGGCAGATAGTACATTCAGAACTGGATTGAGCCTCCGTCAGTACGTTGAACCG
GGTCTACATGGTAGACTGATGGATGTTGTTGACAGGAAGCTTGGTTTGGATTCCGAGAAA
TGGCTTCAGGCTCGAGATGTTTCGCCATGCAGCAGTATTACTGAATGCCTTGTTTCACTG
CTTAGACTTGGGCTGTCTTGCTCTCAGGAATTGCCATCGAGTAGAACGCAAGCCGGAGAT
GTCATCAATGAACTGCGTGCCATCAAAGAGTCTCTCTCGATGTCATCCGACATGTGA

Protein

999 aa

>Os11t0559200-00 Protein kinase, core domain containing protein.
MISLPLLLFVLFFSALLLFPSSSDDDGGGDAAGDELALLSFKSSLLYQGGQSLASWNTSG
HGQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKIPQ
ELSRLIRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLA
LAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTLPT
NAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRMRNLQRL
ELPETLLEAKETNDWKFMTALTNCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSLSIRDN
KISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNKLIGSLPFTIGN
LTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSH
HNLEGSIPKEIGKLKNIVEFHADSNKLSGEIPSTIGECQLLQHLFLQNNFLNGSIPIALT
QLKGLDTLDLSGNNLSGQIPMSLGDMPLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGN
AHICGGIPELHLPTCSLKSRKKKKHQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEV
PATTSMQGHPMITYKQLVKATDGFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVKVLK
LETPKALKSFTSECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLH
PETNDQAEQRHLTLHQRVTILLDVACALDHLHFHGPEPIVHCDIKSSNVLLDADMVAHVG
DFGLARILIEGSSLMQQSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTG
MRPADSTFRTGLSLRQYVEPGLHGRLMDVVDRKLGLDSEKWLQARDVSPCSSITECLVSL
LRLGLSCSQELPSSRTQAGDVINELRAIKESLSMSSDM*

CDS

chr11:20802978..20805597 (+ strand) : 2620 bp

chr11:20805886..20806262 (+ strand) : 377 bp

FASTA

>Os11t0559200-00 class=Sequence position=chr11:20802978..20806262 (+ strand)
ATGATATCAC TCCCATTACT GCTCTTCGTC CTCTTCTTCT CTGCGCTGCT GCTCTTCCCT TCGAGCAGTG ACGACGACGG
TGGTGGTGAT GCTGCCGGCG ACGAACTCGC GCTGCTCTCT TTCAAGTCAT CCCTGCTATA CCAGGGGGGC CAGTCGCTGG
CATCTTGGAA CACGTCCGGC CATGGCCAGC ACTGCACATG GGTGGGTGTC GTGTGCGGCC GCCGGCACCC ACACAGGGTG
GTGAAGCTGC GGCTGCGCTC CTCCAACCTG GCCGGGATCA TCTCGCCGTC GCTGGGCAAC CTATCCTTCC TCAGGACGCT
GCAACTCAGC GACAACCACC TGTCCGGCAA GATACCCCAG GAGCTCAGCC GTCTCATCAG GCTCCAGCAA CTGGTACTGA
ATTTCAACAG CCTATCGGGT GAGATTCCAG CTGCTTTGGG CAATCTAACC AGTCTCTCGG TTCTTGAGCT GACTAACAAT
ACACTGTCCG GAGCAATCCC TTCATCTCTG GGCAAACTCA CAGGTCTCAC TGATCTTGCA CTGGCTGAAA ATACGCTGTC
TGGTTCCATC CCATCATCTT TCGGCCAATT GCGCAGATTA TCTTTCCTTA GCTTAGCCTT TAACAATTTA AGTGGAGCGA
TCCCAGATCC TATTTGGAAC ATCTCCTCTC TCACCATATT CGAAGTCATA TCCAACAAGC TAAGTGGTAC ACTGCCTACA
AATGCATTCA GTAATCTTCC TAGTCTGCAG GAGGTATACA TGTATTACAA CCAGTTTCAT GGTCGTATCC CGGCATCGAT
AGGTAATGCT TCCAACATCT CAATATTTAC CATTGGTTTA AACTCTTTTA GCGGTGTTGT TCCACCGGAG ATTGGAAGGA
TGAGAAATCT TCAGAGACTA GAGCTTCCAG AAACTCTTTT GGAAGCTAAA GAAACAAATG ATTGGAAATT CATGACGGCA
TTGACAAATT GCTCCAATCT TCAAGAAGTG GAACTGGGAG GTTGTAAATT TGGTGGAGTC CTCCCTGATT CTGTTTCCAA
TCTTTCCTCT TCGCTTGTAT CTCTCTCCAT TAGAGATAAC AAAATTTCAG GGAGCTTACC TAGAGATATC GGTAATCTCG
TTAATTTACA ATATCTTTCT CTCGCTAACA ACTCCTTGAC AGGATCCCTT CCCTCTTCCT TCAGCAAGCT TAAAAATTTA
CGTCGTCTCA CTGTAGATAA CAACAAGTTA ATTGGTTCTC TCCCATTCAC CATCGGTAAT CTTACACAAC TAACTAATAT
GGAGGTCCAA TTTAATGCCT TCGGTGGTAC AATACCAAGC ACACTTGGAA ACCTGACCAA GCTGTTTCAA ATAAATCTTG
GCCACAATAA CTTTATAGGG CAAATTCCCA TTGAAATATT TAGCATTCCC GCACTCTCTG AAATTTTGGA TGTGTCCCAT
CATAACTTGG AGGGATCAAT ACCAAAAGAA ATAGGGAAAC TTAAAAATAT TGTCGAATTC CATGCTGATT CGAACAAATT
ATCGGGTGAG ATCCCTAGCA CCATTGGTGA ATGCCAACTT CTGCAGCATC TTTTCCTGCA AAACAATTTC TTAAATGGTA
GCATCCCAAT AGCTCTGACT CAGTTGAAAG GTCTGGACAC ACTTGATCTC TCAGGTAACA ATTTGTCAGG TCAGATACCT
ATGTCCTTAG GGGACATGCC TCTGCTCCAC TCGCTGAACC TTTCGTTCAA CAGCTTCCAC GGTGAAGTGC CAACCAATGG
TGTTTTTGCA AATGCTTCTG AAATTTACAT CCAAGGCAAT GCCCATATTT GCGGTGGCAT ACCTGAACTA CATCTTCCGA
CGTGTTCCTT AAAATCAAGA AAGAAAAAGA AACATCAAAT TCTGCTGTTA GTGGTTGTTA TCTGTCTCGT TTCGACACTT
GCCGTCTTTT CGTTACTCTA CATGCTTCTA ACCTGTCATA AGAGAAGAAA GAAAGAAGTC CCTGCAACGA CATCCATGCA
AGGCCACCCA ATGATCACTT ACAAGCAGCT GGTAAAAGCA ACGGATGGTT TTTCGTCCAG CCATTTGTTG GGTTCTGGAT
CTTTTGGCTC TGTTTACAAA GGAGAATTTG ATAGTCAAGA TGGTGAAATC ACAAGTCTTG TTGCCGTGAA GGTACTAAAG
CTGGAAACTC CAAAGGCACT CAAGAGTTTC ACGTCCGAAT GCGAAACACT GCGAAATACT CGACACCGGA ATCTTGTCAA
GATAGTTACG ATTTGCTCGA GCATCGATAA CAGAGGGAAT GATTTCAAAG CAATTGTGTA TGACTTCATG CCCAATGGCA
GTCTGGAAGA TTGGCTACAC CCTGAAACAA ATGATCAAGC AGAGCAAAGG CACTTGACTC TGCATCAGAG AGTGACCATA
CTACTTGATG TTGCATGTGC ATTGGACCAT CTTCACTTCC ATGGCCCTGA ACCTATTGTA CACTGTGATA TTAAATCAAG
CAATGTGTTG TTAGATGCTG ATATGGTAGC CCATGTTGGA GACTTTGGAC TTGCAAGAAT ACTTATTGAG GGAAGCTCAT
TGATGCAACA GTCAACAAGT TCGATGGGAA TCAGGGGGAC AATTGGTTAC GCAGCACCAG GTTAATCCTA AACTGTTTAT
GTCTACCTCC TTTCATTGTT TTTTTtagat ttgctctggt ccaacaaaaa atacctaaag atacagatac ttgtacctca
caatattaaa tagttttcga tcattgcatt gttagatcta acgatcagga aacgatttgg taccgtgccc gtgaggtatc
ggaatctcaa gatatttttt gttcgaccgt agcaaatcta TTTTTTTGTT TGTTTTCTTC TCTTTAATGT TTTATGACTA
TGAAATAATT TTTATTTCTG GAAAACAGAG TATGGTGTCG GGAACACTGC CTCGACACAT GGAGATATTT ACAGTTATGG
AATTCTAGTG TTGGAAACAG TAACCGGGAT GCGGCCGGCA GATAGTACAT TCAGAACTGG ATTGAGCCTC CGTCAGTACG
TTGAACCGGG TCTACATGGT AGACTGATGG ATGTTGTTGA CAGGAAGCTT GGTTTGGATT CCGAGAAATG GCTTCAGGCT
CGAGATGTTT CGCCATGCAG CAGTATTACT GAATGCCTTG TTTCACTGCT TAGACTTGGG CTGTCTTGCT CTCAGGAATT
GCCATCGAGT AGAACGCAAG CCGGAGATGT CATCAATGAA CTGCGTGCCA TCAAAGAGTC TCTCTCGATG TCATCCGACA
TGTGA