Os11t0578500-01

Locus

Os11g0578500

Description

Heat shock protein DnaJ family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjC77

Oryzabase Gene Name Synonym(s)

DnaJ domain protein C77

Transcript Evidence

AK121330 (DDBJ, Best hit)

Protein Evidence

A3CCL4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Heat shock protein DnaJ (IPR003095)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

J023118F05 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0578500-01)

RiceXPro (AK121330)

Others

Oryzabase (12234)

KEGG (Os11t0578500-01)

Transcript

3756 bp

>Os11t0578500-01 Heat shock protein DnaJ family protein.
GTCTCCTACTCACTCACCTCACCTCTGCCTCTGCTCTTCCTCCAAGAACCTAACCACGCC
CACCGCCCACCACGGTGGCTCGCCGGCGCCGGCCGCCGCGGATCACGTTCCAGCCCCAGC
TCAGCTCGGAGGTAGAGCATGTTAATGCCATTCTGGAACAAGTATATGTGAAGGGTTTCT
TGGTCAAATTTCTGGAATACTTTGATGGAATGCAACAGAGAGGAGGCCTTCAGGGCCAGA
GAAATTGCTGTAAAGAAGCTGGAAAATAGAGACTTTGTCGGCGCCCGCAAGATCGCGATT
AAAGCTCAAAGGCTTTTTCCTGAGCTTGAGAACATCTCCCAGCTGTTAATTATCTGTGAA
GTTCTTTCTTCAGCTGAGGCAAAGATCTCTGGAGAGTTGGATTGGTATGGTGTTCTTCAG
GTGGATAAAATGGCAGACGAAACAGTAATAAGAAGGCAATACAACATACTTTCGTATCGG
CTTCATCCTGATAATAATACTCTGTTTGGTGCCGAAGCCGCATTCAGGTTTGTTTCAGAA
GCTCATGCAATATTGAGTGATCATGTGAAGAGGTCTCTGTATGACACCAAAAGACAGTGT
GCTTCAAGAGAAGTGGCCAAGGAGGCTACACAGCCACCAAACAAGACTGATTCAAACATA
AGCAATGTGGCTGGATCCATGACACCATCTGCTTCTGTGCTTGTATTCTGGACAATATGT
CCGCATTGTCAGAAGCGATTTCTGTACTACCAACGGAACTTTTTGGCCCGCTGCAGTGAT
TGTGGTAAGAGGTTCTTCGCAATCAAACTGCATGAGCAGTCTGTTCCCTCGAGAATCCTA
TCAACTGCTGCAAAAAAGTCTCAGCTTTCAACGTCAGAAATGTTATCATTTCAACGAAGT
AGTGTCCCCAATCAGCATCAACAAGGTAAATGCTTGGTTACAAGAAGCGAGGCCATTCAA
TTTTCAGCAATGAAGCAAACTAAATCTCACATCTGCGCTTTTGACAATGATAAGCCTGGA
ACTTTGGTACCAAAGAGTTCTGATCTTAAGTCCATCTCAGTTAAGAATTTGACTAGAGAA
AGTGCACCTGCAGAGGAAAATGCTGCAGAATCATCCAGTCTTCAGATATTGGGTAAGAGA
AAGCTTTATGTTACCTCTGACAGCAGCCATGGTATGAACTCCAATATTAAGAGGCAAAGG
AAGTATACTTGTCCATCCGATTCTGATTCGAGTAATGAGCAGATATGTAATGATGATGTT
GCTGTTCCTGATAATCAATCTACTGGACAGAATGTTCCCATCGAAGTGGACAGTGAAGAG
GAAAGAAATGCAAGACATGGAAGCAACCAACAAACTTGTAAGAAAAATGTTACTGATACT
GCTTCTCAGAAGTCTGTCAATTCGGTGATTGCCTACCCTTATCCAGACTTTGATTTTTGC
AAGTCCAGAGATGCTGAAGAAACTGATGAATCCATAAAACAATATGGCTGGGCTGGTGAC
ATGGCAGGTAAAGGCCTGGTGACAAGAAGTGACAGAGTTCAATTTTCAGAAATTAGCCAA
GCTAAATCTCATGTGCCTCCTGCTGACAACGATATACCCGGAACTTTGGTACCAAGGAGT
CCTGATCCAAACTCCACCGCTGTGCAGAATTTGACTGGAGAAAGTGTATCAGCAGAGACA
AATGCTCCAGGATCATCCAGTCTTCAGATATTGGGTCGGAGAAAGCTCTGTGATAGCTCT
GACAGCAACCGTGCTATGAACTCTAATATTGAGAGGAAAATGAAGTATAATTCTCCATCT
GATGCTGATTGGAGTACTGAGCAAACATGTAATGATGATGTTGCTGTTACTGAGAATCAA
TTTGCCAAACAACATGTCCCCACCGAAGTGGACAGTGAAGAGGAAGGAAATGAAAAACAT
GGAGACAATCAACAAAGTCATAGGAAAGATGATACTGATACTTCTTCTCAGAATTCTGCC
AATCCTGTGATTGCCTACTCTTCTACAGACTTCTTTGATTTTGACAAGTCCAGAGATGTG
TCCCAAATTGCGGTTGATCAGATCTGGGCAGTATATTAAGGTCATGATTGCATGCCTAGA
GCTTATGCCTGAATAAATCATGTCGATCCTTCCAACCTCAAAGTGCAGTTCACTTGGCTG
GTGCACAACACAGTAAATGAACAAAATTCCAAATCGACCAATGAAAAACTGCCATTTGCT
TGTGGGAACTTCTGCTTAGGAGAAACAGATGTATTGCACAATCCATCAAGGTACTTATCC
CACAGTGTTTCATCGACAGGCAAAAATGGGAACTCCTGTGATATAAATCCTAACATGGGT
GAGGTGTGGGCTCTTTATAAAGGATGGAGCATGCAGTTGAGCTCTCATGCAGATAGATAT
CAATCATATGGGTATGATATTGTGCAAGTCCTTTCTAGTGGCTCAATGGATGATGGTGTC
ACGGTTTCACCGCTGGTCAGGATTGCAGGGTTTGTCAGTCTATTTGCGAAAGTGAAGAAC
GAGTCATGTTTTTCGATATCATCATGTGAGGTACTTCATTTTTCTCACAGTATCCCCTTC
TATAAAACGAACGGAAATGAAAGGGTAGGTGTTGCAGAAGGGTTCCTGGAACTAGACACT
GCAGCTCTTCCAAGTGACTTGGATTCGGCATTTACTTCCATTACTCTTGAATCCTACATG
GCTCTTGACAACAAAACAAATATCGAATTAATCAGTTATGTATGCCCTGATTCAGAATTC
TACAACTTCGAACAAGACCGCTCGCATGATAAGTTTGAAGCTGGCCAGATTTGGGCTCTT
TACAGTGATACTGATAAATTTCCCAACTTCTATGGTTGGGTAAGCAAAGTTGAGATGGAA
CCGTTCAACGTGGATTTGGCCTGGCTTGAGGCTTGCCCTCAACGAGCGCAGGAGAAGCTG
TGGTTGGAGCATGATGTACCTGTGAGCTGTGGTACATTTGAAATCCAAAACATGGAAACA
AAGTTTAATGAAAATTGTGCATTCTCCCATTTAATAGAAACCAAACAAATTGGAGCAAAG
TGCAAGGTTCAAATTCATCCAAAGATAGGTGAGGTCTGGGCCATCTACAAGAACTGGTCA
AATAAGTGGGTTCCTTCCCGCAGCACTCGTGGTACTAAGTATGCTATTGGCAAGATCGTC
GACTCCACTGAAGCTTTCACATTATTTGGTTATCTGACTAAAGTTGATGGTTACATCTCT
GTGTTCAAGCCTGATGTACGAAGGGGAATTCTGAAGATTCCTGTGAAAGAGAACCTGAGG
TTTTCTCATCGAATACCATCGTTTTGTCTCACAAAAGAGAAAGGTGGAAAGCTCCATGAC
TGCTATGAGCTCGACCCAGCTGCTGTTCCTGATGTTTTTCTACACAAGAATTGAAGGAAA
AGAACTCCCACAAAAAAGGACTAATCTTAGAAATTAAGAGTGAAGATATCTCATGATAGA
GTCATCTAGCATTATGATATGTATCTGAGTTTCTGTACAGGGCGCGCCCAATTATGTTAG
AAAAGTATTCATGTTTCATAATCATGACTAATTTCTGTTGAATTTCACGCTTTCTGGTGA
AACTGATCTACAATGCTGATCTATTGCTTTGCTGTCTGAAGAAACTAAGAAGAATATGTA
TTCTTCTCAAGTTTGAATTATGTATTTATGATACATAACATTAATGTACTTATGTGTCTG
ACCATCAGTCAATGTACATGTTCCTATATTTCAGCC

CDS

1875 bp

>Os11t0578500-01 Heat shock protein DnaJ family protein.
ATGGAATGCAACAGAGAGGAGGCCTTCAGGGCCAGAGAAATTGCTGTAAAGAAGCTGGAA
AATAGAGACTTTGTCGGCGCCCGCAAGATCGCGATTAAAGCTCAAAGGCTTTTTCCTGAG
CTTGAGAACATCTCCCAGCTGTTAATTATCTGTGAAGTTCTTTCTTCAGCTGAGGCAAAG
ATCTCTGGAGAGTTGGATTGGTATGGTGTTCTTCAGGTGGATAAAATGGCAGACGAAACA
GTAATAAGAAGGCAATACAACATACTTTCGTATCGGCTTCATCCTGATAATAATACTCTG
TTTGGTGCCGAAGCCGCATTCAGGTTTGTTTCAGAAGCTCATGCAATATTGAGTGATCAT
GTGAAGAGGTCTCTGTATGACACCAAAAGACAGTGTGCTTCAAGAGAAGTGGCCAAGGAG
GCTACACAGCCACCAAACAAGACTGATTCAAACATAAGCAATGTGGCTGGATCCATGACA
CCATCTGCTTCTGTGCTTGTATTCTGGACAATATGTCCGCATTGTCAGAAGCGATTTCTG
TACTACCAACGGAACTTTTTGGCCCGCTGCAGTGATTGTGGTAAGAGGTTCTTCGCAATC
AAACTGCATGAGCAGTCTGTTCCCTCGAGAATCCTATCAACTGCTGCAAAAAAGTCTCAG
CTTTCAACGTCAGAAATGTTATCATTTCAACGAAGTAGTGTCCCCAATCAGCATCAACAA
GGTAAATGCTTGGTTACAAGAAGCGAGGCCATTCAATTTTCAGCAATGAAGCAAACTAAA
TCTCACATCTGCGCTTTTGACAATGATAAGCCTGGAACTTTGGTACCAAAGAGTTCTGAT
CTTAAGTCCATCTCAGTTAAGAATTTGACTAGAGAAAGTGCACCTGCAGAGGAAAATGCT
GCAGAATCATCCAGTCTTCAGATATTGGGTAAGAGAAAGCTTTATGTTACCTCTGACAGC
AGCCATGGTATGAACTCCAATATTAAGAGGCAAAGGAAGTATACTTGTCCATCCGATTCT
GATTCGAGTAATGAGCAGATATGTAATGATGATGTTGCTGTTCCTGATAATCAATCTACT
GGACAGAATGTTCCCATCGAAGTGGACAGTGAAGAGGAAAGAAATGCAAGACATGGAAGC
AACCAACAAACTTGTAAGAAAAATGTTACTGATACTGCTTCTCAGAAGTCTGTCAATTCG
GTGATTGCCTACCCTTATCCAGACTTTGATTTTTGCAAGTCCAGAGATGCTGAAGAAACT
GATGAATCCATAAAACAATATGGCTGGGCTGGTGACATGGCAGGTAAAGGCCTGGTGACA
AGAAGTGACAGAGTTCAATTTTCAGAAATTAGCCAAGCTAAATCTCATGTGCCTCCTGCT
GACAACGATATACCCGGAACTTTGGTACCAAGGAGTCCTGATCCAAACTCCACCGCTGTG
CAGAATTTGACTGGAGAAAGTGTATCAGCAGAGACAAATGCTCCAGGATCATCCAGTCTT
CAGATATTGGGTCGGAGAAAGCTCTGTGATAGCTCTGACAGCAACCGTGCTATGAACTCT
AATATTGAGAGGAAAATGAAGTATAATTCTCCATCTGATGCTGATTGGAGTACTGAGCAA
ACATGTAATGATGATGTTGCTGTTACTGAGAATCAATTTGCCAAACAACATGTCCCCACC
GAAGTGGACAGTGAAGAGGAAGGAAATGAAAAACATGGAGACAATCAACAAAGTCATAGG
AAAGATGATACTGATACTTCTTCTCAGAATTCTGCCAATCCTGTGATTGCCTACTCTTCT
ACAGACTTCTTTGATTTTGACAAGTCCAGAGATGTGTCCCAAATTGCGGTTGATCAGATC
TGGGCAGTATATTAA

Protein

625 aa

>Os11t0578500-01 Heat shock protein DnaJ family protein.
MECNREEAFRAREIAVKKLENRDFVGARKIAIKAQRLFPELENISQLLIICEVLSSAEAK
ISGELDWYGVLQVDKMADETVIRRQYNILSYRLHPDNNTLFGAEAAFRFVSEAHAILSDH
VKRSLYDTKRQCASREVAKEATQPPNKTDSNISNVAGSMTPSASVLVFWTICPHCQKRFL
YYQRNFLARCSDCGKRFFAIKLHEQSVPSRILSTAAKKSQLSTSEMLSFQRSSVPNQHQQ
GKCLVTRSEAIQFSAMKQTKSHICAFDNDKPGTLVPKSSDLKSISVKNLTRESAPAEENA
AESSSLQILGKRKLYVTSDSSHGMNSNIKRQRKYTCPSDSDSSNEQICNDDVAVPDNQST
GQNVPIEVDSEEERNARHGSNQQTCKKNVTDTASQKSVNSVIAYPYPDFDFCKSRDAEET
DESIKQYGWAGDMAGKGLVTRSDRVQFSEISQAKSHVPPADNDIPGTLVPRSPDPNSTAV
QNLTGESVSAETNAPGSSSLQILGRRKLCDSSDSNRAMNSNIERKMKYNSPSDADWSTEQ
TCNDDVAVTENQFAKQHVPTEVDSEEEGNEKHGDNQQSHRKDDTDTSSQNSANPVIAYSS
TDFFDFDKSRDVSQIAVDQIWAVY*

5'UTR

chr11:21839186..21839316 (+ strand) : 131 bp

chr11:21839916..21839988 (+ strand) : 73 bp

CDS

chr11:21839989..21841863 (+ strand) : 1875 bp

3'UTR

chr11:21841864..21843540 (+ strand) : 1677 bp

FASTA

>Os11t0578500-01 class=Sequence position=chr11:21839186..21843540 (+ strand)
GTCTCCTACT CACTCACCTC ACCTCTGCCT CTGCTCTTCC TCCAAGAACC TAACCACGCC CACCGCCCAC CACGGTGGCT
CGCCGGCGCC GGCCGCCGCG GATCACGTTC CAGCCCCAGC TCAGCTCGGA GGTACCATCC GTTCACGCAT TTGCGGTCCA
TTGCCCCCTT GTTCTTCCGG TCTTCCCCTT CTTGGGTAGG TTGGCTGAAG CCGGGTTATG CGTGCGTGTT AGGGTTTTTT
TTTTGGATCG GAGGTTTGGT TTTGCGTTTC GGGGGTTAGT GTGTTCTTCG CGAGGATAAT GGCCAGAGAT TTGATCGTGC
AGAGCTCTTG ATTTGGGTGC CCTAGGAGGC TAGGGTAGTA GACATCAAGT AGGATCGAAA TATTTCCCCT CTTTCTTTTT
CTGCAATTTT TTTAAAGATT TTTATGCATG TATGCCACTT CAAAATGTGG TGGTTTGGAA AGATGCCATC CAGTTTTTTT
TAAAAAAAAA ACATTTCAAA ATGGATGCCT TTTGTTTTGA AGGAACTGTA TGTCAATTTT CCAAATTACA ATTTTCTCAA
GTGAATAAGA CTACAAGAGT ATACCCAAAT GTGATTTCTT TTTTTCCCAG AGTATTCATA ATTTTGCCAT ATATATTTCT
TCTGTTAATA AAAATGTCCT TTTGTATGCA TGCAGGGCCT GATGCACTGA AAGTTCTTCT CACATTTTAT TGTTCTTGAT
AACATGATAG GTAGAGCATG TTAATGCCAT TCTGGAACAA GTATATGTGA AGGGTTTCTT GGTCAAATTT CTGGAATACT
TTGATGGAAT GCAACAGAGA GGAGGCCTTC AGGGCCAGAG AAATTGCTGT AAAGAAGCTG GAAAATAGAG ACTTTGTCGG
CGCCCGCAAG ATCGCGATTA AAGCTCAAAG GCTTTTTCCT GAGCTTGAGA ACATCTCCCA GCTGTTAATT ATCTGTGAAG
TTCTTTCTTC AGCTGAGGCA AAGATCTCTG GAGAGTTGGA TTGGTATGGT GTTCTTCAGG TGGATAAAAT GGCAGACGAA
ACAGTAATAA GAAGGCAATA CAACATACTT TCGTATCGGC TTCATCCTGA TAATAATACT CTGTTTGGTG CCGAAGCCGC
ATTCAGGTTT GTTTCAGAAG CTCATGCAAT ATTGAGTGAT CATGTGAAGA GGTCTCTGTA TGACACCAAA AGACAGTGTG
CTTCAAGAGA AGTGGCCAAG GAGGCTACAC AGCCACCAAA CAAGACTGAT TCAAACATAA GCAATGTGGC TGGATCCATG
ACACCATCTG CTTCTGTGCT TGTATTCTGG ACAATATGTC CGCATTGTCA GAAGCGATTT CTGTACTACC AACGGAACTT
TTTGGCCCGC TGCAGTGATT GTGGTAAGAG GTTCTTCGCA ATCAAACTGC ATGAGCAGTC TGTTCCCTCG AGAATCCTAT
CAACTGCTGC AAAAAAGTCT CAGCTTTCAA CGTCAGAAAT GTTATCATTT CAACGAAGTA GTGTCCCCAA TCAGCATCAA
CAAGGTAAAT GCTTGGTTAC AAGAAGCGAG GCCATTCAAT TTTCAGCAAT GAAGCAAACT AAATCTCACA TCTGCGCTTT
TGACAATGAT AAGCCTGGAA CTTTGGTACC AAAGAGTTCT GATCTTAAGT CCATCTCAGT TAAGAATTTG ACTAGAGAAA
GTGCACCTGC AGAGGAAAAT GCTGCAGAAT CATCCAGTCT TCAGATATTG GGTAAGAGAA AGCTTTATGT TACCTCTGAC
AGCAGCCATG GTATGAACTC CAATATTAAG AGGCAAAGGA AGTATACTTG TCCATCCGAT TCTGATTCGA GTAATGAGCA
GATATGTAAT GATGATGTTG CTGTTCCTGA TAATCAATCT ACTGGACAGA ATGTTCCCAT CGAAGTGGAC AGTGAAGAGG
AAAGAAATGC AAGACATGGA AGCAACCAAC AAACTTGTAA GAAAAATGTT ACTGATACTG CTTCTCAGAA GTCTGTCAAT
TCGGTGATTG CCTACCCTTA TCCAGACTTT GATTTTTGCA AGTCCAGAGA TGCTGAAGAA ACTGATGAAT CCATAAAACA
ATATGGCTGG GCTGGTGACA TGGCAGGTAA AGGCCTGGTG ACAAGAAGTG ACAGAGTTCA ATTTTCAGAA ATTAGCCAAG
CTAAATCTCA TGTGCCTCCT GCTGACAACG ATATACCCGG AACTTTGGTA CCAAGGAGTC CTGATCCAAA CTCCACCGCT
GTGCAGAATT TGACTGGAGA AAGTGTATCA GCAGAGACAA ATGCTCCAGG ATCATCCAGT CTTCAGATAT TGGGTCGGAG
AAAGCTCTGT GATAGCTCTG ACAGCAACCG TGCTATGAAC TCTAATATTG AGAGGAAAAT GAAGTATAAT TCTCCATCTG
ATGCTGATTG GAGTACTGAG CAAACATGTA ATGATGATGT TGCTGTTACT GAGAATCAAT TTGCCAAACA ACATGTCCCC
ACCGAAGTGG ACAGTGAAGA GGAAGGAAAT GAAAAACATG GAGACAATCA ACAAAGTCAT AGGAAAGATG ATACTGATAC
TTCTTCTCAG AATTCTGCCA ATCCTGTGAT TGCCTACTCT TCTACAGACT TCTTTGATTT TGACAAGTCC AGAGATGTGT
CCCAAATTGC GGTTGATCAG ATCTGGGCAG TATATTAAGG TCATGATTGC ATGCCTAGAG CTTATGCCTG AATAAATCAT
GTCGATCCTT CCAACCTCAA AGTGCAGTTC ACTTGGCTGG TGCACAACAC AGTAAATGAA CAAAATTCCA AATCGACCAA
TGAAAAACTG CCATTTGCTT GTGGGAACTT CTGCTTAGGA GAAACAGATG TATTGCACAA TCCATCAAGG TACTTATCCC
ACAGTGTTTC ATCGACAGGC AAAAATGGGA ACTCCTGTGA TATAAATCCT AACATGGGTG AGGTGTGGGC TCTTTATAAA
GGATGGAGCA TGCAGTTGAG CTCTCATGCA GATAGATATC AATCATATGG GTATGATATT GTGCAAGTCC TTTCTAGTGG
CTCAATGGAT GATGGTGTCA CGGTTTCACC GCTGGTCAGG ATTGCAGGGT TTGTCAGTCT ATTTGCGAAA GTGAAGAACG
AGTCATGTTT TTCGATATCA TCATGTGAGG TACTTCATTT TTCTCACAGT ATCCCCTTCT ATAAAACGAA CGGAAATGAA
AGGGTAGGTG TTGCAGAAGG GTTCCTGGAA CTAGACACTG CAGCTCTTCC AAGTGACTTG GATTCGGCAT TTACTTCCAT
TACTCTTGAA TCCTACATGG CTCTTGACAA CAAAACAAAT ATCGAATTAA TCAGTTATGT ATGCCCTGAT TCAGAATTCT
ACAACTTCGA ACAAGACCGC TCGCATGATA AGTTTGAAGC TGGCCAGATT TGGGCTCTTT ACAGTGATAC TGATAAATTT
CCCAACTTCT ATGGTTGGGT AAGCAAAGTT GAGATGGAAC CGTTCAACGT GGATTTGGCC TGGCTTGAGG CTTGCCCTCA
ACGAGCGCAG GAGAAGCTGT GGTTGGAGCA TGATGTACCT GTGAGCTGTG GTACATTTGA AATCCAAAAC ATGGAAACAA
AGTTTAATGA AAATTGTGCA TTCTCCCATT TAATAGAAAC CAAACAAATT GGAGCAAAGT GCAAGGTTCA AATTCATCCA
AAGATAGGTG AGGTCTGGGC CATCTACAAG AACTGGTCAA ATAAGTGGGT TCCTTCCCGC AGCACTCGTG GTACTAAGTA
TGCTATTGGC AAGATCGTCG ACTCCACTGA AGCTTTCACA TTATTTGGTT ATCTGACTAA AGTTGATGGT TACATCTCTG
TGTTCAAGCC TGATGTACGA AGGGGAATTC TGAAGATTCC TGTGAAAGAG AACCTGAGGT TTTCTCATCG AATACCATCG
TTTTGTCTCA CAAAAGAGAA AGGTGGAAAG CTCCATGACT GCTATGAGCT CGACCCAGCT GCTGTTCCTG ATGTTTTTCT
ACACAAGAAT TGAAGGAAAA GAACTCCCAC AAAAAAGGAC TAATCTTAGA AATTAAGAGT GAAGATATCT CATGATAGAG
TCATCTAGCA TTATGATATG TATCTGAGTT TCTGTACAGG GCGCGCCCAA TTATGTTAGA AAAGTATTCA TGTTTCATAA
TCATGACTAA TTTCTGTTGA ATTTCACGCT TTCTGGTGAA ACTGATCTAC AATGCTGATC TATTGCTTTG CTGTCTGAAG
AAACTAAGAA GAATATGTAT TCTTCTCAAG TTTGAATTAT GTATTTATGA TACATAACAT TAATGTACTT ATGTGTCTGA
CCATCAGTCA ATGTACATGT TCCTATATTT CAGCC

Locus: Os11g0578500

Loading...

Locus: Os11g0578500

Loading...