Os11t0587600-01

Locus

Os11g0587600

Description

Similar to PDR-like ABC transporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR3

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 3

Oryzabase Gene Symbol Synonym(s)

OsABCG48, OsPDR3

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 48, pleiotropic drug resistance 3

Transcript Evidence

AK121517 (DDBJ, Best hit)

Protein Evidence

Q8GU84 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

ABC-2 type transporter (IPR013525)

Full-length cDNA

J033027B16 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0587600-01)

Others

Oryzabase (12021)

Transcript

5192 bp

>Os11t0587600-01 Similar to PDR-like ABC transporter.
AGCTTAATTCCAATGCTGCCTTAGCTCTAGCAATCTAGCTAGGTAATTTAGCTAAGTAAG
CTAGCGACGCTATCTGGGATGGCGTCGTCGGCGGAGGCGGCTGCGGCGATGGCGGCGGCG
CCGTCGGCGAGCGGGCGGCGGAGCATGAGCTGGGGGTCGTCGATCTCGCAGTCGTTCCGG
CAGGCGGAGGCGGACGACCCGTTCGGTCGCGCGGCGTCGCAGCAGGGGCACGACGACGAC
GAGGAGAACCTCCGGTGGGCGGCGCTCGAGAAGCTCCCCACCTACGACCGCATGCGCCGC
GGCGTCATCCGCACCGCGCTCCTCCATCACGACGGCGGCGGCGACGGCGGCGGCGCGGCG
GCGGCGGCGAAGGACGGGAGGATGGAGCTCGTCGACATCCAGAAGCTCGCCGCCGGCAAC
CTCGGCCGCGCGCTCCTCGACCGCGTGTTCCAGGACGACAGCGAGCGCTTCCTCCGCCGC
CTCCGGGACCGCATCGACATGGTGGGGATCGAGCTGCCGACGATCGAGGTGAGGTACGAG
CAGCTGTCGATCCAGGCGGAGGTGTTCGTCGGCAGCCGTGCGCTGCCCACGCTCACCAAC
GCCGCCACCAACGTCCTCCAGGGTCTCATTGGACGATTTGGTTCTTCAAATAAGAGGACC
ATTAACATACTGCAAGATGTTAGTGGCATCATCAAGCCATCCAGGATGACACTTCTTCTT
GGGCCTCCATCCTCGGGAAAGAGCACACTAATGCGAGCACTTACAGGGAAGCTTGATAAA
AACCTCAAGGTGTCCGGCGACATCACATACTGTGGACACACATTTTCTGAGTTCTACCCT
GAGAGGACCAGTGCATATGTCAGTCAGTATGATCTTCATAATGCAGAGATGACTGTGAGA
GAGACATTGGATTTCTCTGGGCGGTGCTTAGGCATTGGTGCAAGATATGACATGCTCGCG
GAACTCGCGAGAAGGGAGCGCAATGCAGGCATTAAGCCAGATCCTGAGATCGATGCTTTC
ATGAAAGCTACTGCAGTGCAAGGGCATAAAACTAACATCACTACAGATGTTACTCTCAAG
GCACTTGGGTTGGACATTTGTGCTGATATTATTATTGGGGATGAGATGATTAGAGGAATT
TCTGGTGGGCAAAAGAAGCGTGTGACAACAGGGGAGATGTTAACGGGACCAGCACGGGCA
TTGTTCATGGATGAAATATCCACCGGTCTAGATAGCTCTAGCACATTTGAGATTGTCAAG
TATATTGGGCATTTGGTCCATGTGATGAATGAGACTGTGATGATATCCCTCCTGCAGCCA
CCACCGGAGACCTACAATCTTTTTGATGACATAATTCTACTATCAGAAGGATATATAGTC
TATCACGGACCACGTGAGAACATCTTGGAATTCTTCGAAAATGCTGGTTTCCGATGCCCT
GAAAGGAAAGGAATCGCTGATTTCCTTCAAGAGGTCACTTCCAAGAAAGACCAGCAGCAG
TACTGGTACCATGACCAAGAACGGTATCGGTATGTGTCAGTTCCAGAGTTTGCACAACGT
TTCAAGTCATTCCATGTAGGTCAGAAAATGCAGAAGGAGATGCAAATTCCTTATGACAAG
TCCAGCACACATCCTGCTGCATTGACAACTACCAAGTATGGGCTATCCAGTTGGGAGTCA
CTCAGGGCAGTGATGTCAAGAGAGTGGTTATTGATGAAGCGCAACTCCTTCATCTACATT
TTCAAGGTCACCCAGTTGATCATCCTTGCCTTCATGTCCATGACTGTGTTCCTCAGAACA
AAGATGCCTAGTGGGACAATCTCTGATGGCACTAAATTCCTTGGGGCTCTCACCTTTAGT
TTGATCACCATCTTGTTCAATGGCTTTGCTGAGCTACAACTGACCATAAAGAAGCTTCCT
GTGTTCTACAAACATAGAGATTTCTTGTTCTTCCCTGCATGGACCTTTGGAGTAGCAAAT
ATCCTCTTGAAAGTTCCTGTTTCTCTTGTAGAGGCGGCGGTATGGGTTGTGCTCACATAC
TATGTGATGGGGTTTGCACCCTCTGCAGGAAGGTAAATTTGTATGGTTCATTTTCTAGTT
TTAGTGCTAAAATTTGCATACAAAGCTTCATGACGAGTTCTTTTATATATTGATTTTAGG
TTCTTTCGTCAATTTATAGCTTTCTTTGTTACTCACCAAATGGCAATGGCTATGTTCCGA
TTTCTTGGTGCTATTTTGAAAACAATGGTTGTGGCCAATACTTTTGGGATGTTTGTGCTG
CTTATTGTCTTCATTTTTGGAGGATTTCTCATATCTAGAAGTAAGTATGTTCCCATGTAA
ATATATTTATATTTCCTAGGAATAAGCAATGAAGAATCAATATTGGCCATTTAATATTTA
TGGATGATACTAATGTCCTTGATTTGGCACGTACAGATGACATCAAGCCATGGTGGATTT
GGGGTTACTGGGCATCTCCTATGATGTATAGTCAACAAGCAATATCAATCAATGAGTTCC
TTGCTAGTAGATGGGCTATTCCAAATACTGATGCAACAATTGATGAGCCAACTGTTGGCA
AGGCTATTCTCAAATCCAAAGGCTTGATTACTAGTGATGGGGGGTTTTGGATTTCCATTG
GAGCCCTTATAGGATTCCTTGTTGTGTTCAATATCTTATACATTTTGGCCCTTACATACT
TGAGTCCTGGTGGCAGCTCAAACACAATAGTTTCAGATGAAGATAGTGAAGATAAGACGG
ACATGAAAACAAGAAATGAACAACAAATGTCCCAAATTGTACACAATAATGGAGCTAGTA
ATACATCTGCAACATCGTCAATCCCCATGAGTGAGACCTTATTTATCCATTTTATATGAT
TGTAGCCTTTATAATATTATCAAGCTCAAGTATATTATCTGTATTATGACTACTGATGTC
TTACTAAGTAATTTTACATCATGGTAAAATTTACACATTTTATTCAACAGGTGGAAGCAG
ATCAACAAATCAGCAAAGTAGATCACAAATTGTCTTGCCTTTCCAACCCCTTTCACTTTG
TTTCAACCATGTAAACTACTATGTGGATATGCCAACAGAAATGAAAGAGCAAGGATTCAC
AGAAAGCCGTCTCCAGTTACTATCTGATATCAGTGGAGTTTTCAGACCAGGTGTTTTGAC
AGCATTAGTTGGTGTAAGTGGAGCTGGCAAGACCACCCTAATGGATGTCTTAGCAGGAAG
GAAAACAAGTGGAGTAATTGAAGGAGACATCACCCTCTCTGGTTATCCAAAGAAACAAGA
AACTTTTGCACGCATTAGTGGTTACTGTGAACAGACTGATATTCATTCACCAAATGTTAC
TGTCTATGAATCCATTCTCTACTCTGCTTGGCTACGTCTTTCGTCAGATGTTGACACCAA
TACGAGGAAGATGTTCGTGGATGAAGTCATGTCCCTTGTAGAGCTTGATGTGTTACGTAA
TGCTTTGGTGGGTCTTCCTGGAGTTAGTGGTTTATCAACTGAACAGAGAAAGAGGCTCAC
AATTGCAGTGGAGTTGGTAGCAAACCCTTCAGTAATATTCATGGATGAGCCAACTTCTGG
ACTTGATGCTAGAGCTGCAGCAATTGTCATGCGAACCGTGAGAAATACCGTCAACACGGG
ACGCACTGTGGTTTGCACAATTCATCAACCCAGCATCGATATTTTTGAGTCTTTTGATGA
GCTTTTGCTATTGAAAAGGGGAGGGCAAGTTATTTATGCTGGTGAACTCGGCCGCCACTC
CCATAAACTAGTTGAATATTTTGAGGCAGTTCCAGGTGTTCCAAAGATAACAGAAGGATA
TAATCCTGCAACATGGATGCTAGAAGTCACCTCCCCTATAGCTGAGGCTCGTCTTAATGT
AAATTTTGCTGAAATTTATGCTAATTCTGAGCTTTATAGGCCCAGGAAAAACCAAGAGCT
AATCAAGGAATTGAGCACTCCCCCACCAGGATATCAAGATCTCTCATTTCCTACAAAGTA
TTCTCAAAATTTCTATAGTCAATGCATTGCAAACTTTTGGAAGCAATATCGTTCTTATTG
GAAGAATCCACCATACAATGCCATGCGCTATCTTATGACATTGCTCAATGGCCTTGTCTT
TGGCACGGTATTTTGGCAAAAAGGAACTAAGATATCATCACAACAAGATTTGTTCAATTT
GCTTGGAGCCACTTATGCTGCAACTTTCTTCCTTGGGGCTGCCAATTGTATCACAGTTCA
ACCTGTTGTTTCCATCGAAAGAACAGTCTTCTACCGCGAAAGGGCAGCAGGGATGTACTC
TTCATTGTCCTATGCATTTGCTCAGGCATGCGTGGAGGTCATCTACAACATCTTACAGGG
GATTCTATACACTATTATCATCTATGCAATGATTGGATATGACTGGAAAGCCGACAAATT
CTTCTATTTCATGTTCTTTATTGTAGCAAGTTTCAACTACTTCACATTGTTTGGGATGAT
GTTGGTGGCATGCACCCCATCTGCAATGCTTGCAAACATTCTCATATCCTTTGTACTTCC
TCTCTGGAATCTTTTTGCTGGGTTCCTCGTTGTTAGGCCGTTGATACCGATTTGGTGGAG
GTGGTACTACTGGGCAAACCCCGTGTCATGGACCATCTATGGTGTTGTGGCGTCACAGTT
TGGTAAAAATGGTGATGTTCTTTCGGTTCCCGGTGGGAGCCCTACGGTAGTGAAGCAATT
CTTGGAGGACAACCTAGGGATGCGGCATAGTTTCCTAGGATATGTTGTGCTCACACATTT
TGGCTACATCATCGTTTTCTTCTTCATCTTTGGCTATGCCATCAAGTACTTCAACTTCCA
GAAACGATAGAGATGGTATGTTATGGCATAGAGTGACATTATTTTTGGCCGCCACTGCCA
CTTGCAGCTAAAGAGGGCTACTACACAATTACTTAGTTAAGTTAGAAGTGCTTGTAGATT
GTTCTAGTTTGTAAACATTCACTTCATGTATCTATATACACACCAATGCTATTCTAAGCC
ATGGATGTGATTTGTTATTCCATTTGCAGACCAATAGATCATCCTAAGATTGTATAAACC
TCTAGGAATTGTAAAAGTTGGCCCACAAGTGTAAAAAAACCCTCTCATTTGCGTCCTAAC
CTTGCCGGACCTCACCCATGATCATAAAATCC

CDS

1998 bp

>Os11t0587600-01 Similar to PDR-like ABC transporter.
ATGGCGTCGTCGGCGGAGGCGGCTGCGGCGATGGCGGCGGCGCCGTCGGCGAGCGGGCGG
CGGAGCATGAGCTGGGGGTCGTCGATCTCGCAGTCGTTCCGGCAGGCGGAGGCGGACGAC
CCGTTCGGTCGCGCGGCGTCGCAGCAGGGGCACGACGACGACGAGGAGAACCTCCGGTGG
GCGGCGCTCGAGAAGCTCCCCACCTACGACCGCATGCGCCGCGGCGTCATCCGCACCGCG
CTCCTCCATCACGACGGCGGCGGCGACGGCGGCGGCGCGGCGGCGGCGGCGAAGGACGGG
AGGATGGAGCTCGTCGACATCCAGAAGCTCGCCGCCGGCAACCTCGGCCGCGCGCTCCTC
GACCGCGTGTTCCAGGACGACAGCGAGCGCTTCCTCCGCCGCCTCCGGGACCGCATCGAC
ATGGTGGGGATCGAGCTGCCGACGATCGAGGTGAGGTACGAGCAGCTGTCGATCCAGGCG
GAGGTGTTCGTCGGCAGCCGTGCGCTGCCCACGCTCACCAACGCCGCCACCAACGTCCTC
CAGGGTCTCATTGGACGATTTGGTTCTTCAAATAAGAGGACCATTAACATACTGCAAGAT
GTTAGTGGCATCATCAAGCCATCCAGGATGACACTTCTTCTTGGGCCTCCATCCTCGGGA
AAGAGCACACTAATGCGAGCACTTACAGGGAAGCTTGATAAAAACCTCAAGGTGTCCGGC
GACATCACATACTGTGGACACACATTTTCTGAGTTCTACCCTGAGAGGACCAGTGCATAT
GTCAGTCAGTATGATCTTCATAATGCAGAGATGACTGTGAGAGAGACATTGGATTTCTCT
GGGCGGTGCTTAGGCATTGGTGCAAGATATGACATGCTCGCGGAACTCGCGAGAAGGGAG
CGCAATGCAGGCATTAAGCCAGATCCTGAGATCGATGCTTTCATGAAAGCTACTGCAGTG
CAAGGGCATAAAACTAACATCACTACAGATGTTACTCTCAAGGCACTTGGGTTGGACATT
TGTGCTGATATTATTATTGGGGATGAGATGATTAGAGGAATTTCTGGTGGGCAAAAGAAG
CGTGTGACAACAGGGGAGATGTTAACGGGACCAGCACGGGCATTGTTCATGGATGAAATA
TCCACCGGTCTAGATAGCTCTAGCACATTTGAGATTGTCAAGTATATTGGGCATTTGGTC
CATGTGATGAATGAGACTGTGATGATATCCCTCCTGCAGCCACCACCGGAGACCTACAAT
CTTTTTGATGACATAATTCTACTATCAGAAGGATATATAGTCTATCACGGACCACGTGAG
AACATCTTGGAATTCTTCGAAAATGCTGGTTTCCGATGCCCTGAAAGGAAAGGAATCGCT
GATTTCCTTCAAGAGGTCACTTCCAAGAAAGACCAGCAGCAGTACTGGTACCATGACCAA
GAACGGTATCGGTATGTGTCAGTTCCAGAGTTTGCACAACGTTTCAAGTCATTCCATGTA
GGTCAGAAAATGCAGAAGGAGATGCAAATTCCTTATGACAAGTCCAGCACACATCCTGCT
GCATTGACAACTACCAAGTATGGGCTATCCAGTTGGGAGTCACTCAGGGCAGTGATGTCA
AGAGAGTGGTTATTGATGAAGCGCAACTCCTTCATCTACATTTTCAAGGTCACCCAGTTG
ATCATCCTTGCCTTCATGTCCATGACTGTGTTCCTCAGAACAAAGATGCCTAGTGGGACA
ATCTCTGATGGCACTAAATTCCTTGGGGCTCTCACCTTTAGTTTGATCACCATCTTGTTC
AATGGCTTTGCTGAGCTACAACTGACCATAAAGAAGCTTCCTGTGTTCTACAAACATAGA
GATTTCTTGTTCTTCCCTGCATGGACCTTTGGAGTAGCAAATATCCTCTTGAAAGTTCCT
GTTTCTCTTGTAGAGGCGGCGGTATGGGTTGTGCTCACATACTATGTGATGGGGTTTGCA
CCCTCTGCAGGAAGGTAA

Protein

665 aa

>Os11t0587600-01 Similar to PDR-like ABC transporter.
MASSAEAAAAMAAAPSASGRRSMSWGSSISQSFRQAEADDPFGRAASQQGHDDDEENLRW
AALEKLPTYDRMRRGVIRTALLHHDGGGDGGGAAAAAKDGRMELVDIQKLAAGNLGRALL
DRVFQDDSERFLRRLRDRIDMVGIELPTIEVRYEQLSIQAEVFVGSRALPTLTNAATNVL
QGLIGRFGSSNKRTINILQDVSGIIKPSRMTLLLGPPSSGKSTLMRALTGKLDKNLKVSG
DITYCGHTFSEFYPERTSAYVSQYDLHNAEMTVRETLDFSGRCLGIGARYDMLAELARRE
RNAGIKPDPEIDAFMKATAVQGHKTNITTDVTLKALGLDICADIIIGDEMIRGISGGQKK
RVTTGEMLTGPARALFMDEISTGLDSSSTFEIVKYIGHLVHVMNETVMISLLQPPPETYN
LFDDIILLSEGYIVYHGPRENILEFFENAGFRCPERKGIADFLQEVTSKKDQQQYWYHDQ
ERYRYVSVPEFAQRFKSFHVGQKMQKEMQIPYDKSSTHPAALTTTKYGLSSWESLRAVMS
REWLLMKRNSFIYIFKVTQLIILAFMSMTVFLRTKMPSGTISDGTKFLGALTFSLITILF
NGFAELQLTIKKLPVFYKHRDFLFFPAWTFGVANILLKVPVSLVEAAVWVVLTYYVMGFA
PSAGR*

5'UTR

chr11:22282326..22282403 (- strand) : 78 bp

CDS

chr11:22281904..22282325 (- strand) : 422 bp

chr11:22281688..22281808 (- strand) : 121 bp

chr11:22279700..22279782 (- strand) : 83 bp

chr11:22279526..22279610 (- strand) : 85 bp

chr11:22278872..22279162 (- strand) : 291 bp

chr11:22278677..22278767 (- strand) : 91 bp

chr11:22277626..22278530 (- strand) : 905 bp

3'UTR

chr11:22277162..22277625 (- strand) : 464 bp

chr11:22276858..22277023 (- strand) : 166 bp

chr11:22276378..22276768 (- strand) : 391 bp

chr11:22275906..22276238 (- strand) : 333 bp

chr11:22275505..22275795 (- strand) : 291 bp

chr11:22275344..22275427 (- strand) : 84 bp

chr11:22274950..22275084 (- strand) : 135 bp

chr11:22274565..22274797 (- strand) : 233 bp

chr11:22274278..22274449 (- strand) : 172 bp

chr11:22273528..22273782 (- strand) : 255 bp

chr11:22272841..22273432 (- strand) : 592 bp

FASTA

>Os11t0587600-01 class=Sequence position=chr11:22272841..22282403 (- strand)
AGCTTAATTC CAATGCTGCC TTAGCTCTAG CAATCTAGCT AGGTAATTTA GCTAAGTAAG CTAGCGACGC TATCTGGGAT
GGCGTCGTCG GCGGAGGCGG CTGCGGCGAT GGCGGCGGCG CCGTCGGCGA GCGGGCGGCG GAGCATGAGC TGGGGGTCGT
CGATCTCGCA GTCGTTCCGG CAGGCGGAGG CGGACGACCC GTTCGGTCGC GCGGCGTCGC AGCAGGGGCA CGACGACGAC
GAGGAGAACC TCCGGTGGGC GGCGCTCGAG AAGCTCCCCA CCTACGACCG CATGCGCCGC GGCGTCATCC GCACCGCGCT
CCTCCATCAC GACGGCGGCG GCGACGGCGG CGGCGCGGCG GCGGCGGCGA AGGACGGGAG GATGGAGCTC GTCGACATCC
AGAAGCTCGC CGCCGGCAAC CTCGGCCGCG CGCTCCTCGA CCGCGTGTTC CAGGACGACA GCGAGCGCTT CCTCCGCCGC
CTCCGGGACC GCATCGACAT GTATGGATTG CATCGCCATG GATTTCGTAC AATTAAAGCT TCATTGAAAT TGAACTATAG
CTCCATTAAT CAAGCTGATC GATGGTTGGT TGCAGGGTGG GGATCGAGCT GCCGACGATC GAGGTGAGGT ACGAGCAGCT
GTCGATCCAG GCGGAGGTGT TCGTCGGCAG CCGTGCGCTG CCCACGCTCA CCAACGCCGC CACCAACGTC CTCCAGGTAT
ATACTCCTTC CTTCCGTTCC TAAATATAAA CATTTTTTTA GTAAACAACA GTTCGGCAAA TGCCAAACGA CACTCCCCTT
TCTCGACTTG CAGTCCCTTG TTTTCCACTA CAAACTGATA AACGTTATGT TTTTTTTTCT TTTTAAAGTT TTATGGGGAA
GTTTCTTTAA AGAAACCATA TTAATCTATT ATAAGTTTTT TCTAAGCTAA TACGTTATTA GCTATGCGCT AATGAGTGAG
ATTAGTTTTC AACCTTATAT GATGAGCATA GCCTAAGTTG TTAAGCCCAG AGCAAGTGTT TGAAGAAAAG GTTCCCTTTC
GGTTATCTGG TTTGGTCACG TTTTAAATTT TGAATTATCC ATGTAAGAAC CTGATTGGCT TGAAATGCAT AGATTCTCGC
GTATTGGAAC CAGTGTTCCG CAAATGCTTA TATTTTTTTT TTGTATAAAT TCAAATCCTA CAGATGTTAT ACTTCGGAAT
GGAGGGAGTA CAAAGACTTG AGAGGTTCTC TTCCACGTAT GCCATAGTAA TTAATTAGTC AACAGCCGTC CGTTAGATAT
GATTAAAAGT CTTCCCTGTA CAATATTATC ATATAAAATA GCTTTAAAAT AATACTATAC GTACCAGTTA GCGATTCCTT
TTAAATTTTT GAAAAAAAAA ATCCTGTGAT ATTTAATTTG TAGAAACAAA GGGAATTTCT GGTATATTAA TAATTAAGAA
AAAGTAAACT CACGTAACAG AGGCTGGCAA ACCATTGAGT AACAGAACTT GATGTAAAGG AGAGAATTAG TTAATAGCAG
TCGTCACATC ATAAAATTTA AATTTGTCAA TGACATATTA TCGTACGCAG AATATATGTT TAATCACTGG TGGTATATAT
ATATAATAGA GTTTCTTGAA AACATATATC TATATATCTA AGTACATCTA TCTCAGATTC CTTCTAGATC TTCTTTCTTA
CCGGAAATGA TGAAATAGTG GTTGAATTGT CCTCTGATAA ATTATAAATT ATATGGGCGT AATTTAATAA TGGGACTCTT
AGACAAAGTA AGATTAGATA ATTATTATTT GTTTTGTCCA GTGGCATCTA ACTTAAACAG ATGTCTAGTA GCTAACAAGA
TTGATTATTT GTGCCTTTCT TATTCGAGGA TAGTCGTCAC CTGCACATGC AAGCAAAGAT GGGCAGCTTA GATGTGTCAA
ACCTTCTAGA ATCCCTCCAT AAAAAAAAAG GGAGAAAAAT CTTCTACAAT CCCTTAGGTT TAAGCATGCA CTGCACATGG
GAGATGGCCT TGCAAAATCT CAAGCAAAAT CTCCAGCAAA GCACAGCTAG GGTTCATATG CATATTCTAT CGCATATATG
ACTCGTAGTC CGTGTCACTG GCTCGATCGA AGAGTTCAAT CAATCAATCA TCTTTGTTGT TTTGCTTAAG AAAACTAGAG
GGCAAGTGTC AGTGTGTCAC TAATTTGCTC AAAGAGTTTG ATCAATTTTC CTTCGATTTT TCAAAAAATT CTCGACCAGA
AAGGGCATGG AGCTCCGTCT ATTTAAGCAT GTGTTAGACG ATATGTTTGT AATGTGGTGG GTGTGTATAT GTTTTACTAT
AACAAAAAGA AGAGGAGAAA AGGACGTTTA AAGAAATTTT TAAACAAGAA CAGTGAAAGA TGGAACTTCT TCTTCAGAGG
GCCATCAGGC AAAACAAAAG CTCAAAAAAG AAGGCCAGAA CATCTCCCTG AGGCCCAAGT TAGAAATTGA CCTATCTTTG
TGCCAAACTT CCTACTAATA TGTTTTTTTC ATAGCTATAT GTTATGGTGG TGGACTATCA TCTTTTGGGC TTCGGTCCAA
AAACAAATCA ATTTTTGTGT GTGCTTGATG GATAGAAAAT GTGATGATGT TTACTGGACA GGGTCTCATT GGACGATTTG
GTTCTTCAAA TAAGAGGACC ATTAACATAC TGCAAGATGT TAGTGGCATC ATCAAGCCAT CCAGGTAGAA ACATACACTA
CCAATGTACT AGTTTCCAAA TGTTCGTATT TTCAAAAGAA GTACTGAACT ATAGTTCTTT TTTCTTATTT CAGGATGACA
CTTCTTCTTG GGCCTCCATC CTCGGGAAAG AGCACACTAA TGCGAGCACT TACAGGGAAG CTTGATAAAA ACCTCAAGGT
AATTAAACTC AAATCCACTC ATCTGGTAAA TTATTTActc cctccgggtt gataatactt gtcgtttcgg acaagagcac
ggtctccaaa aaaataactt tgacaactat tttctattat aatatatata tagaaatatc aacaaatata tgattttgat
tttattgaag tactttttaa gactaatcta cacatatgat ttttatattt ttaagataaa tattttaaaa attaattgta
gtcaaagatt ttaaagtttg actttaccct tattcaaaac gactaatatt atcaacccgg agagagTACA TGTTAACTCA
TTCCTGCCAT ATGCTCATTC ATCCTATTGC GACCAACCCA GGTGTCCGGC GACATCACAT ACTGTGGACA CACATTTTCT
GAGTTCTACC CTGAGAGGAC CAGTGCATAT GTCAGTCAGT ATGATCTTCA TAATGCAGAG ATGACTGTGA GAGAGACATT
GGATTTCTCT GGGCGGTGCT TAGGCATTGG TGCAAGATAT GACATGCTCG CGGAACTCGC GAGAAGGGAG CGCAATGCAG
GCATTAAGCC AGATCCTGAG ATCGATGCTT TCATGAAAGC TACTGCAGTG CAAGGGCATA AAACTAACAT CACTACAGAT
GTTACTCTCA AGGTGAGATT CTGATCTATC TGTTGCCTAT ATATATATTT GTCCAAGAGG CAAATTAAAT AAAAGAAAAG
AAAATGCACT TTTTTTTCAT TTACCTTGAT GTGTAGGCAC TTGGGTTGGA CATTTGTGCT GATATTATTA TTGGGGATGA
GATGATTAGA GGAATTTCTG GTGGGCAAAA GAAGCGTGTG ACAACAGGTA TGCATTCAAA ATATTCAAAC CATGATAACT
TCAGTAGAAT AAGTTGCAAT GATTAAAATC AATTGTTTAA ATTTTAGACC ATTTGTTTGC TCTAATTTCA AATTAATTGT
CTAGAATCAT TTTTTTTACT TGCTTGGTGA CAGGGGAGAT GTTAACGGGA CCAGCACGGG CATTGTTCAT GGATGAAATA
TCCACCGGTC TAGATAGCTC TAGCACATTT GAGATTGTCA AGTATATTGG GCATTTGGTC CATGTGATGA ATGAGACTGT
GATGATATCC CTCCTGCAGC CACCACCGGA GACCTACAAT CTTTTTGATG ACATAATTCT ACTATCAGAA GGATATATAG
TCTATCACGG ACCACGTGAG AACATCTTGG AATTCTTCGA AAATGCTGGT TTCCGATGCC CTGAAAGGAA AGGAATCGCT
GATTTCCTTC AAGAGGTCAC TTCCAAGAAA GACCAGCAGC AGTACTGGTA CCATGACCAA GAACGGTATC GGTATGTGTC
AGTTCCAGAG TTTGCACAAC GTTTCAAGTC ATTCCATGTA GGTCAGAAAA TGCAGAAGGA GATGCAAATT CCTTATGACA
AGTCCAGCAC ACATCCTGCT GCATTGACAA CTACCAAGTA TGGGCTATCC AGTTGGGAGT CACTCAGGGC AGTGATGTCA
AGAGAGTGGT TATTGATGAA GCGCAACTCC TTCATCTACA TTTTCAAGGT CACCCAGTTG ATCATCCTTG CCTTCATGTC
CATGACTGTG TTCCTCAGAA CAAAGATGCC TAGTGGGACA ATCTCTGATG GCACTAAATT CCTTGGGGCT CTCACCTTTA
GTTTGATCAC CATCTTGTTC AATGGCTTTG CTGAGCTACA ACTGACCATA AAGAAGCTTC CTGTGTTCTA CAAACATAGA
GATTTCTTGT TCTTCCCTGC ATGGACCTTT GGAGTAGCAA ATATCCTCTT GAAAGTTCCT GTTTCTCTTG TAGAGGCGGC
GGTATGGGTT GTGCTCACAT ACTATGTGAT GGGGTTTGCA CCCTCTGCAG GAAGGTAAAT TTGTATGGTT CATTTTCTAG
TTTTAGTGCT AAAATTTGCA TACAAAGCTT CATGACGAGT TCTTTTATAT ATTGATTTTA GGTTCTTTCG TCAATTTATA
GCTTTCTTTG TTACTCACCA AATGGCAATG GCTATGTTCC GATTTCTTGG TGCTATTTTG AAAACAATGG TTGTGGCCAA
TACTTTTGGG ATGTTTGTGC TGCTTATTGT CTTCATTTTT GGAGGATTTC TCATATCTAG AAGTAAGTAT GTTCCCATGT
AAATATATTT ATATTTCCTA GGAATAAGCA ATGAAGAATC AATATTGGCC ATTTAATATT TATGGATGAT ACTAATGTCC
TTGATTTGGC ACGTACAGAT GACATCAAGC CATGGTGGAT TTGGGGTTAC TGGGCATCTC CTATGATGTA TAGTCAACAA
GCAATATCAA TCAATGAGTT CCTTGCTAGT AGATGGGCTA TTGTAAGTTT CTTACTGAAA CTTATATTAT GTTTGATGTT
TCTCTCCTCT CTCTAAATTA ATTTATAGGA AACCGAGACA TCTCATTCTT GTTAATGTTG TGCCATTTTA ACAAACGAAG
AACATTTTTT CTTGCTGCAG CCAAATACTG ATGCAACAAT TGATGAGCCA ACTGTTGGCA AGGCTATTCT CAAATCCAAA
GGCTTGATTA CTAGTGATGG GGGGTTTTGG ATTTCCATTG GAGCCCTTAT AGGATTCCTT GTTGTGTTCA ATATCTTATA
CATTTTGGCC CTTACATACT TGAGTCGTAA GCACCATTGC TTTCCTCATT ACGCTGTTAC TTTGATGTCA TATTTATTCA
CAATACTTAT AATTCATTTA AATTATTCCT CCCAGCTGGT GGCAGCTCAA ACACAATAGT TTCAGATGAA GATAGTGAAG
ATAAGACGGA CATGAAAACA AGAAATGAAC AACAAATGTC CCAAATTGTA CACAATAATG GAGCTAGTAA TACATCTGCA
ACATCGTCAA TCCCCATGAG TGAGACCTTA TTTATCCATT TTATATGATT GTAGCCTTTA TAATATTATC AAGCTCAAGT
ATATTATCTG TATTATGACT ACTGATGTCT TACTAAGTAA TTTTACATCA TGGTAAAATT TACACATTTT ATTCAACAGG
TGGAAGCAGA TCAACAAATC AGCAAAGTAG ATCACAAATT GTCTTGCCTT TCCAACCCCT TTCACTTTGT TTCAACCATG
TAAACTACTA TGTGGATATG CCAACAGTAA GCTTACCTTC CCCCTTCAGA AAAATCATGC TAAAATAGTA AAATATGAAT
TCTCACTTTG ACAACTTTAA CATTTACGTA TGTCAGCTAA AAATCAAACT GAGGCTAACA TGTTTTTCAT TGTTAATTAT
TCTAGGAAAT GAAAGAGCAA GGATTCACAG AAAGCCGTCT CCAGTTACTA TCTGATATCA GTGGAGTTTT CAGACCAGGT
GTTTTGACAG CATTAGTTGG TGTAAGTGGA GCTGGCAAGA CCACCCTAAT GGATGTCTTA GCAGGAAGGA AAACAAGTGG
AGTAATTGAA GGAGACATCA CCCTCTCTGG TTATCCAAAG AAACAAGAAA CTTTTGCACG CATTAGTGGT TACTGTGAAC
AGACTGATAT TCATTCACCA AATGTTACTG TCTATGAATC CATTCTCTAC TCTGCTTGGC TACGTCTTTC GTCAGATGTT
GACACCAATA CGAGGAAGGT AATACTAAAC TATGTTCCAC ACTCATGATG TTGTATTGCT GAGCTCTATA TATGTGAACA
TCCAAATAGT AATTTAATCA AATTTAACTG AACTCTTCAC TCATGTAGAT GTTCGTGGAT GAAGTCATGT CCCTTGTAGA
GCTTGATGTG TTACGTAATG CTTTGGTGGG TCTTCCTGGA GTTAGTGGTT TATCAACTGA ACAGAGAAAG AGGCTCACAA
TTGCAGTGGA GTTGGTAGCA AACCCTTCAG TAATATTCAT GGATGAGCCA ACTTCTGGAC TTGATGCTAG AGCTGCAGCA
ATTGTCATGC GAACCGTGAG AAATACCGTC AACACGGGAC GCACTGTGGT TTGCACAATT CATCAACCCA GCATCGATAT
TTTTGAGTCT TTTGATGAGG TCCCTCTCTT TGCTATTTCT CTTTGAAATT CTAAAAAAAA ATTCATGTAA ATAAATAACG
ATTGTTTCTT CTCCAGCTTT TGCTATTGAA AAGGGGAGGG CAAGTTATTT ATGCTGGTGA ACTCGGCCGC CACTCCCATA
AACTAGTTGA ATATTTTGAG GTGAATGTCT TGTTTTCAAT GCAATATACA TGTTCTAGTT TGTGAACAAC AAATATTTCT
TTTATGCCCT ACTAAACTAG AATTATGGCA ACACAATCAT GCTCGTATTA TTTTAAAAAA ATGTTTTTGT TACTTATTTG
CCAAGTTCTG ACTTGCTCAT AAATATGGTC AATGATCTTG GAAGATTAGC AAATAATAAT TATTTGTAGG TGTAACAAAC
TATATGTGGC ATCACATGAG ATTATCTTTC ACCCTTCAGG CAGTTCCAGG TGTTCCAAAG ATAACAGAAG GATATAATCC
TGCAACATGG ATGCTAGAAG TCACCTCCCC TATAGCTGAG GCTCGTCTTA ATGTAAATTT TGCTGAAATT TATGCTAATT
CTGAGCTTTA TAGGTATGTA GCCTCAATCG AAACCCTCCT TTTGTTACTT TCTTAACTAC CAATGCTTGT TTACATTGAA
ATTAGTTTGG ATCCCAAACA AACAAACAAA ATTAGCAACT ATGGTCGATT TTGTTACTGA CATTAAGGTC AACTTTCATA
AATATGCCCA GGAAAAACCA AGAGCTAATC AAGGAATTGA GCACTCCCCC ACCAGGATAT CAAGATCTCT CATTTCCTAC
AAAGTATTCT CAAAATTTCT ATAGTCAATG CATTGCAAAC TTTTGGAAGC AATATCGTTC TTATTGGAAG AATCCACCAT
ACAATGCCAT GCGCTATCTT ATGACATTGC TCAATGGCCT TGTCTTTGGC ACGGTATTTT GGCAAAAAGG AACTAAGATG
TATGATCCTA TACTTGACAT CAATGCTGAT GGAATTAGTA GTGATGCTAT ATTAAACTCT TTGGTGGCAT ACTAACGCTT
TTAAATATGT TTGATTTGTG TTTTACATGA ATAGATCATC ACAACAAGAT TTGTTCAATT TGCTTGGAGC CACTTATGCT
GCAACTTTCT TCCTTGGGGC TGCCAATTGT ATCACAGTTC AACCTGTTGT TTCCATCGAA AGAACAGTCT TCTACCGCGA
AAGGGCAGCA GGGATGTACT CTTCATTGTC CTATGCATTT GCTCAGGTAA TGTGTGAAAT TAACATGTTG ACTGTTGTTA
GCTGCATTGA GTGAAATGTG ATTGTTTTGG TTGCACTAAC TATGCTCCAA ATAAATGGGA TATCTACTGC TCCTATGCTT
TGACTTATTG AAGAAGCATC GGAAAGAGTT TGGAGAGAAC ATGAGCAATA GATATTGATA TAACGAGCAT AATGGCATCG
CCAATAAACT AGTATAATAT TGGTCATTTG TGAACTAAGA GCTCATCAAA ATGTCTCCTC ATTTTTTAAT CAAAGATAGT
TATAAATAAT TGCGGTTCAG ATCAAAATAT AAGGGAAAAT AAAATTAAAA AATTACAATA TAAACCTCAT AATATATTTT
TTACTGGGAA CCTCATAATA TTTTATGAAG CAATAATATA TTAAATGAGT TTGAGAATGT AAAGGTTGCA TACCAACCAA
AAAAAATGAA GAGGGTGTGG AAGGTACAAC ATGATTTTTA ATTTAGAGTC AATTCGTGCA GGCATGCGTG GAGGTCATCT
ACAACATCTT ACAGGGGATT CTATACACTA TTATCATCTA TGCAATGATT GGATATGACT GGAAAGCCGA CAAATTCTTC
TATTTCATGT TCTTTATTGT AGCAAGTTTC AACTACTTCA CATTGTTTGG GATGATGTTG GTGGCATGCA CCCCATCTGC
AATGCTTGCA AACATTCTCA TATCCTTTGT ACTTCCTCTC TGGAATCTTT TTGCTGGGTT CCTCGTTGTT AGGCCGGTAA
GCTAGAAAGT GTTTTAATTT CTCACAGTTA TGCATTGATA AGTAGCTAGC TTAGCTATGT TCTCTTATCG ACTTGGTGTG
TGTTGATGCA GTTGATACCG ATTTGGTGGA GGTGGTACTA CTGGGCAAAC CCCGTGTCAT GGACCATCTA TGGTGTTGTG
GCGTCACAGT TTGGTAAAAA TGGTGATGTT CTTTCGGTTC CCGGTGGGAG CCCTACGGTA GTGAAGCAAT TCTTGGAGGA
CAACCTAGGG ATGCGGCATA GTTTCCTAGG ATATGTTGTG CTCACACATT TTGGCTACAT CATCGTTTTC TTCTTCATCT
TTGGCTATGC CATCAAGTAC TTCAACTTCC AGAAACGATA GAGATGGTAT GTTATGGCAT AGAGTGACAT TATTTTTGGC
CGCCACTGCC ACTTGCAGCT AAAGAGGGCT ACTACACAAT TACTTAGTTA AGTTAGAAGT GCTTGTAGAT TGTTCTAGTT
TGTAAACATT CACTTCATGT ATCTATATAC ACACCAATGC TATTCTAAGC CATGGATGTG ATTTGTTATT CCATTTGCAG
ACCAATAGAT CATCCTAAGA TTGTATAAAC CTCTAGGAAT TGTAAAAGTT GGCCCACAAG TGTAAAAAAA CCCTCTCATT
TGCGTCCTAA CCTTGCCGGA CCTCACCCAT GATCATAAAA TCC

Locus: Os11g0587600

Loading...

Locus: Os11g0587600

Loading...