Os11t0591550-00

Locus

Os11g0591550

Description

ThiJ/PfpI domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDJ-1F, DJ-1F

Oryzabase Gene Name Synonym(s)

DJ-1/PfpI domain containing protein F, DJ-1 protein F

Transcript Evidence

ab initio prediction

Protein Evidence

NP_001068186.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

ThiJ/PfpI (IPR002818)

Expression Databases

TENOR (Os11t0591550-00)

Others

Oryzabase (20917)

Transcript

678 bp

>Os11t0591550-00 ThiJ/PfpI domain containing protein.
ATGGCACCGTGCAAGAAGGTGCTGATGCTGTGCGGCGACTACATGGAGGACTACGAGGCC
GCCGTGCCGTTCTACGCGCTCGCCGCGTTCGGCGTCGCCGTCGACTGCGTCGCGCCGGGG
AAGAAGCCCCCCGGCGACGCCTGCCTCACCGCCGTCCACGAGTTCCTCGGCCACGACCTC
TACACCGAGCTCCCGGGCCACCGGTTCGCGGTCACCGCCGACTTCGCCGCGGCCGCCGCG
GCTGACGCGTCGCGCTACGACGCGCTCGTCGTCCCCGGCGGGAGGTTCGTCGAGCGGCTC
AGCGTGGACCCGCTCGCCGTGTCGCTCGTCGCGGCATTCGCCGGGGAGGGGGAGACGGCG
ACGCGCAGGCGGCCGGTGGTCGTGACGTGCCATAGCCAGCTGCTGCTCGCCGCCGCGGGC
GCCATGCGCGGCGTCAGGTGCACGGCGTTCTTCAGCATGCGGCGTGTGGTGGAGCTCGCC
GGCGGGACGTGGGTGGAGCCTGACCCACTCGGCCTCTGCGTCGCCGACGGCAACGTCCTG
AGCGCCATCGGCTGGCCCGCGCACGGCGAGATCATCAGGGAGCTCCTCCGCGCCATGGGC
GCCCGCGTCGCCGGCGGCCGCGGCCAGGCCGTCCTCTTCCTCTGCGCCGTACCTCTCGCT
CTCTCTCGCCGCCGTTAA

CDS

678 bp

>Os11t0591550-00 ThiJ/PfpI domain containing protein.
ATGGCACCGTGCAAGAAGGTGCTGATGCTGTGCGGCGACTACATGGAGGACTACGAGGCC
GCCGTGCCGTTCTACGCGCTCGCCGCGTTCGGCGTCGCCGTCGACTGCGTCGCGCCGGGG
AAGAAGCCCCCCGGCGACGCCTGCCTCACCGCCGTCCACGAGTTCCTCGGCCACGACCTC
TACACCGAGCTCCCGGGCCACCGGTTCGCGGTCACCGCCGACTTCGCCGCGGCCGCCGCG
GCTGACGCGTCGCGCTACGACGCGCTCGTCGTCCCCGGCGGGAGGTTCGTCGAGCGGCTC
AGCGTGGACCCGCTCGCCGTGTCGCTCGTCGCGGCATTCGCCGGGGAGGGGGAGACGGCG
ACGCGCAGGCGGCCGGTGGTCGTGACGTGCCATAGCCAGCTGCTGCTCGCCGCCGCGGGC
GCCATGCGCGGCGTCAGGTGCACGGCGTTCTTCAGCATGCGGCGTGTGGTGGAGCTCGCC
GGCGGGACGTGGGTGGAGCCTGACCCACTCGGCCTCTGCGTCGCCGACGGCAACGTCCTG
AGCGCCATCGGCTGGCCCGCGCACGGCGAGATCATCAGGGAGCTCCTCCGCGCCATGGGC
GCCCGCGTCGCCGGCGGCCGCGGCCAGGCCGTCCTCTTCCTCTGCGCCGTACCTCTCGCT
CTCTCTCGCCGCCGTTAA

Protein

226 aa

>Os11t0591550-00 ThiJ/PfpI domain containing protein.
MAPCKKVLMLCGDYMEDYEAAVPFYALAAFGVAVDCVAPGKKPPGDACLTAVHEFLGHDL
YTELPGHRFAVTADFAAAAAADASRYDALVVPGGRFVERLSVDPLAVSLVAAFAGEGETA
TRRRPVVVTCHSQLLLAAAGAMRGVRCTAFFSMRRVVELAGGTWVEPDPLGLCVADGNVL
SAIGWPAHGEIIRELLRAMGARVAGGRGQAVLFLCAVPLALSRRR*

CDS

chr11:22491486..22492163 (+ strand) : 678 bp

FASTA

>Os11t0591550-00 class=Sequence position=chr11:22491486..22492163 (+ strand)
ATGGCACCGT GCAAGAAGGT GCTGATGCTG TGCGGCGACT ACATGGAGGA CTACGAGGCC GCCGTGCCGT TCTACGCGCT
CGCCGCGTTC GGCGTCGCCG TCGACTGCGT CGCGCCGGGG AAGAAGCCCC CCGGCGACGC CTGCCTCACC GCCGTCCACG
AGTTCCTCGG CCACGACCTC TACACCGAGC TCCCGGGCCA CCGGTTCGCG GTCACCGCCG ACTTCGCCGC GGCCGCCGCG
GCTGACGCGT CGCGCTACGA CGCGCTCGTC GTCCCCGGCG GGAGGTTCGT CGAGCGGCTC AGCGTGGACC CGCTCGCCGT
GTCGCTCGTC GCGGCATTCG CCGGGGAGGG GGAGACGGCG ACGCGCAGGC GGCCGGTGGT CGTGACGTGC CATAGCCAGC
TGCTGCTCGC CGCCGCGGGC GCCATGCGCG GCGTCAGGTG CACGGCGTTC TTCAGCATGC GGCGTGTGGT GGAGCTCGCC
GGCGGGACGT GGGTGGAGCC TGACCCACTC GGCCTCTGCG TCGCCGACGG CAACGTCCTG AGCGCCATCG GCTGGCCCGC
GCACGGCGAG ATCATCAGGG AGCTCCTCCG CGCCATGGGC GCCCGCGTCG CCGGCGGCCG CGGCCAGGCC GTCCTCTTCC
TCTGCGCCGT ACCTCTCGCT CTCTCTCGCC GCCGTTAA

Locus: Os11g0591550

Loading...

Locus: Os11g0591550

Loading...