Os11t0598500-00

Locus

Os11g0598500

Description

NB-ARC domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

ab initio prediction

Protein Evidence

Q2R1N9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

NB-ARC (IPR002182)

Expression Databases

TENOR (Os11t0598500-00)

Others

KEGG (Os11t0598500-00)

Transcript

3873 bp

>Os11t0598500-00 NB-ARC domain containing protein.
ATGACTGAGCTCGCTTCTGGCGCCGTGAGCTCACTGCTGGTGGTCATCCGCAACGAGGCG
GCTCTTCTCGGCGGTGTCCGGGACGACGTGCAGTTCATCAAGGAGGAGATGGAGAGCATG
CACAGCTTCCTGGGGCACCTGGCCAGGAGCGCTCCACAGGGTGGCGAGCACGATGAGCAG
GTGTGTACATGGATGAAACAGGTGCGGCTGCTCGCCCAGGACTGCAACAATTGCATCGAC
CTCTACCTGTACTCTGGGAATCCAGAGATTCACCGCGCCAAGGGCAGACTCCGGCGACAC
CTCTGGTGGGCTTACTGGTACCTGCGCAAGATGGTCGCGCAGCACCGCGCGGCCATCCAG
CTATGCCAGCTCAAGGACCGGGCGCGGGACGTCGGCGAGCGACGGATGAGGTACGGCGTG
GAGGTTCCAGCCACGACAAAGGCTGCTGCACCTGACGCAGAAGGTGGCTATGCTGCTGGA
GATGATGAAGACTATGAGGATCATTCTGCTCGAAGGGCCGTCTATGAGCCCCCCGCTCTG
GAAGACTACGTGAACGCAAAACTATTGGAGTGGGCAGAAGAAATTCCTCCAGACGCCATT
GAGACGTTGTCCATCGCCATTGTGGCACCGGATACAGATAACAAGGAAGTCCTTGATCTT
GCACGCGATACTTTGGTTGTTCCAGGCAACTACTACCATCGCAGTATCACGGTCAACGTC
CCGGCGGTGCACGCCGATTTTTTACCGCTACGACCTAAGGAGATTCTCTACTACATCTTA
CGGGAGCTCGAGCCCGGATCCCAGAAGCACGTCACATATCAAGGTGACCCTTGGCAAGAT
TACTACAATATTTACTGTGGCAAAAAAAGGGTGCTTCATAAAATCAAAAGGAATATAGAA
AAGATGAATGTTTACAAGAAGCTTGAGAAGATCAAGAGTGATATTAAAGATGGACAACAT
AAGAGTGACAAGCAGCTGCTGCTTCAACTACAAAAGAAGGGTGTGGATCAGGTGGATCTA
CATGTACTCGTTCAGCTATTGCTGCTCCAGTCTCAACAAGACCAAGCAAACAACAAAGCA
GTAGACATGTATAAATTACCAGAGTGGAACTACGATAACATCATGAAAATAGCAAGGAAG
CTTAAGAAGCATATGGAAGCAGACGAGGAGCTTAATGAGCAAATTAGTGTAGAAAAGAGA
ACAACTAAGCAAGGAGGAGGAGGAGAGAACAAGGAGGAGAAAGACAAAGGAGATGGAGAC
AGAGAAGAGGGGAAGGAGGAGAACGAGAAAGACAAAGGAGAAGCAGACGGAGAAGGAGAG
CAGGAGGAGGAGATGAAGGACAAGGAAAAAGGAGGAGAAGAGAGGAAGGAGGAGCCGCAC
CACGAGAAGCAGGAGCACAAGAAGGAAAAGGAAGTGAAAGAAGAAGAGAGGAAGGAGGAG
CAGAACAAGGAGAAAGAGGAGAGGGAAGGGACAGAAGAAAAACAAGTAGGAGGAGGGGAG
AAAAAAGAAGAAAAAGAAGACGGTGATGATGATGGCGTCATCGACGACAATTACGATGAG
GAGGAGGAGGAGGAGGAAGAAGATGACGACCCGATTCATCTTCATGAAGCTCAATACGTA
CAAATTCTACTAGAAGTGTTCCCAAAGATCACCAGCAGCAAGGCCCAGCAGCAGGACAAA
TCAGAGGCCAAGCAAGCTACAAACACCGCAACGACTACATTGGATGAGGTACGAATCAAA
CAAATGATCAATGACGCAAAACGAGATATCTTAAGGGAGCTGCGGGGAGGCAAATCTGAT
AAGAATGAAGCAACAGGAGAACCTGATGTTCCACCTGATAAGAATCAACCAACAGGTGAA
CATGCAGGTGTTCCGGACCAAAATGGAGAGGCTTGTTTTGAAGAATTAGAGCTGAAGATC
GAAGAAATCAAGCAGGAACTTAAAGAGCAGCTGAAGATCAAAGGGATCGTGGACAAGATC
AAACATCACTTACAGGGTGAGTGCCCCCTCATTATCCTAAAAGTTGATGACATGATGGAT
GGATCCAGATGGGAGGAGTTCAGAAGGGCTTTGAGCCTATTAGAATGCAGTGCCGATGCA
CTGATCTTCACCACAGAGAGCACCGAACAGGCTAAAGGATATTGCTATCCACCGCGAGAA
CCTATAGATCACTGTTCTCATGTTGGTCTCTACCATCATACAGTGCTCGAACTTACTAGC
AAGCAGAAGAATAAAAGCAACTATGACCCCCGGATTTTTCTTGACATCTTGAAGGAGTGT
GAGGGGCATGAATTCTGCATGAGGATCTTCACCCATGCTGTGTATGCTAACCCCAAGAAG
AGCACTGAAGAGTTAAGCAAGCTGCACAGCACCCTGCAGGATTCACAAAAATCATTTGAC
GCAATAGCTAAGAATATGCTCATGTACTCTTACAATGATCTGCCTAAAGAATACAAATCC
TGCTTGTTGTACCTAGCTATCTTCCCCAAGGGACAGAAGATCAGGCGGTCAACCTTGATT
GGACGGTGGGTTACAGAAGGGTTGACATTCAAGGAAGATTGGCCCAGTTCTGTGCGTCAG
GCAAATCAATGTTTTGATGCCCTCATCCGTCGGTGGCTTGTTTATCCTGCTGATATTGGT
GCCACAGGAAAGATCAAGAGCTGTGAAGTAGGTGATCTAGTTCATGGGTTCATTACCACA
ATTGCTAGAAAACAACACATTGTGGAGACACGCCTATCACATCACTTGGCTCGCCACTTC
TCCATTTTCAATGATCTCCGACTCCGCAGTTCCGATAGAATTCAAACGTTCTTCCAAAGC
CTCTCACAATCATCTCGAGTATCCCTACTGAAGGTTCTAGATCTAGAAGGTTGTCAGTGC
TTTGGTGTTAAGAATCAGAGGTACCTCAAGGACATCTGCAACAAGATGTTACTGCTCAAG
TATCTGAGCCTAAAGGGAACAAATATTACCCAACTGCCCAGAGAAATCAACTGCCTCCGT
GAGCTAGAGGTATTGGATATCCGAGAAACCATGGTGCCAGCAAATGCAACGGTTAATGTC
CTGCTCTTGAAGCTGAAGCGTCTACTTGCTGGTCACATTGACCCAAGTCTAAGAAATTTT
CGCACTAGCGTTCATATTCCTCACAGGATAGACAAGATGGTAAACATAGAGGTACTATCT
AATGTCAAGGCCCAGCGCAGTGATGATTTGGAAGATATTGGAAAGCTATGGCAGCTGAGG
AAGCTAGGTGTGGTTATTAATGCTAAGAAAAGTCACCTCGAGAAGTTGCTTAAAGCAATC
AGCGACCTACATGAGTGCATCCGTTCTCTGACAATCACTATTCCCACAACCACACTCGAG
GGTACTCCTTCAAACCCAGAGTTACCAGATCATATTGACTCTAACCTTCCCCATCCCAAG
AAACTTGAGAGTCTAAGCATCAGTGGAGCCAGGTATCTTTTTCCATTGTTGATCAAAAGT
GATAATAACAAGCTTGCCAAGGTAACTCTAAGTAGCACACAACTGAACCAAGATGATCTG
GAGGTCCTCGCCAAGCTACCCAAGTTACAGTGTGTTAGGCTCCGACACATTTCATGCACA
GAGAGCATGCTCATCTTCAAGAAAGATGATTTCAAATGTCTCAAGTACCTTCTTATTGAG
GGCTTTAACTTGACTAATATCACTTTTGAGAATAGATCAGCCTGTGAGCTCGAGAAGATG
GTTTTATCTTCCACCAGCATAGAGTCTATCTCTGGAGTTGATAGGCTTCCAAAATTCAAA
GAGCTTGAGTTGAACAACAGCCCTGTCCCGAATGAGGTGAAAGAAGCCATTGAAAACAAT
AAAAGGATAAATCTTAAATGTAATGAACCATGA

CDS

3873 bp

>Os11t0598500-00 NB-ARC domain containing protein.
ATGACTGAGCTCGCTTCTGGCGCCGTGAGCTCACTGCTGGTGGTCATCCGCAACGAGGCG
GCTCTTCTCGGCGGTGTCCGGGACGACGTGCAGTTCATCAAGGAGGAGATGGAGAGCATG
CACAGCTTCCTGGGGCACCTGGCCAGGAGCGCTCCACAGGGTGGCGAGCACGATGAGCAG
GTGTGTACATGGATGAAACAGGTGCGGCTGCTCGCCCAGGACTGCAACAATTGCATCGAC
CTCTACCTGTACTCTGGGAATCCAGAGATTCACCGCGCCAAGGGCAGACTCCGGCGACAC
CTCTGGTGGGCTTACTGGTACCTGCGCAAGATGGTCGCGCAGCACCGCGCGGCCATCCAG
CTATGCCAGCTCAAGGACCGGGCGCGGGACGTCGGCGAGCGACGGATGAGGTACGGCGTG
GAGGTTCCAGCCACGACAAAGGCTGCTGCACCTGACGCAGAAGGTGGCTATGCTGCTGGA
GATGATGAAGACTATGAGGATCATTCTGCTCGAAGGGCCGTCTATGAGCCCCCCGCTCTG
GAAGACTACGTGAACGCAAAACTATTGGAGTGGGCAGAAGAAATTCCTCCAGACGCCATT
GAGACGTTGTCCATCGCCATTGTGGCACCGGATACAGATAACAAGGAAGTCCTTGATCTT
GCACGCGATACTTTGGTTGTTCCAGGCAACTACTACCATCGCAGTATCACGGTCAACGTC
CCGGCGGTGCACGCCGATTTTTTACCGCTACGACCTAAGGAGATTCTCTACTACATCTTA
CGGGAGCTCGAGCCCGGATCCCAGAAGCACGTCACATATCAAGGTGACCCTTGGCAAGAT
TACTACAATATTTACTGTGGCAAAAAAAGGGTGCTTCATAAAATCAAAAGGAATATAGAA
AAGATGAATGTTTACAAGAAGCTTGAGAAGATCAAGAGTGATATTAAAGATGGACAACAT
AAGAGTGACAAGCAGCTGCTGCTTCAACTACAAAAGAAGGGTGTGGATCAGGTGGATCTA
CATGTACTCGTTCAGCTATTGCTGCTCCAGTCTCAACAAGACCAAGCAAACAACAAAGCA
GTAGACATGTATAAATTACCAGAGTGGAACTACGATAACATCATGAAAATAGCAAGGAAG
CTTAAGAAGCATATGGAAGCAGACGAGGAGCTTAATGAGCAAATTAGTGTAGAAAAGAGA
ACAACTAAGCAAGGAGGAGGAGGAGAGAACAAGGAGGAGAAAGACAAAGGAGATGGAGAC
AGAGAAGAGGGGAAGGAGGAGAACGAGAAAGACAAAGGAGAAGCAGACGGAGAAGGAGAG
CAGGAGGAGGAGATGAAGGACAAGGAAAAAGGAGGAGAAGAGAGGAAGGAGGAGCCGCAC
CACGAGAAGCAGGAGCACAAGAAGGAAAAGGAAGTGAAAGAAGAAGAGAGGAAGGAGGAG
CAGAACAAGGAGAAAGAGGAGAGGGAAGGGACAGAAGAAAAACAAGTAGGAGGAGGGGAG
AAAAAAGAAGAAAAAGAAGACGGTGATGATGATGGCGTCATCGACGACAATTACGATGAG
GAGGAGGAGGAGGAGGAAGAAGATGACGACCCGATTCATCTTCATGAAGCTCAATACGTA
CAAATTCTACTAGAAGTGTTCCCAAAGATCACCAGCAGCAAGGCCCAGCAGCAGGACAAA
TCAGAGGCCAAGCAAGCTACAAACACCGCAACGACTACATTGGATGAGGTACGAATCAAA
CAAATGATCAATGACGCAAAACGAGATATCTTAAGGGAGCTGCGGGGAGGCAAATCTGAT
AAGAATGAAGCAACAGGAGAACCTGATGTTCCACCTGATAAGAATCAACCAACAGGTGAA
CATGCAGGTGTTCCGGACCAAAATGGAGAGGCTTGTTTTGAAGAATTAGAGCTGAAGATC
GAAGAAATCAAGCAGGAACTTAAAGAGCAGCTGAAGATCAAAGGGATCGTGGACAAGATC
AAACATCACTTACAGGGTGAGTGCCCCCTCATTATCCTAAAAGTTGATGACATGATGGAT
GGATCCAGATGGGAGGAGTTCAGAAGGGCTTTGAGCCTATTAGAATGCAGTGCCGATGCA
CTGATCTTCACCACAGAGAGCACCGAACAGGCTAAAGGATATTGCTATCCACCGCGAGAA
CCTATAGATCACTGTTCTCATGTTGGTCTCTACCATCATACAGTGCTCGAACTTACTAGC
AAGCAGAAGAATAAAAGCAACTATGACCCCCGGATTTTTCTTGACATCTTGAAGGAGTGT
GAGGGGCATGAATTCTGCATGAGGATCTTCACCCATGCTGTGTATGCTAACCCCAAGAAG
AGCACTGAAGAGTTAAGCAAGCTGCACAGCACCCTGCAGGATTCACAAAAATCATTTGAC
GCAATAGCTAAGAATATGCTCATGTACTCTTACAATGATCTGCCTAAAGAATACAAATCC
TGCTTGTTGTACCTAGCTATCTTCCCCAAGGGACAGAAGATCAGGCGGTCAACCTTGATT
GGACGGTGGGTTACAGAAGGGTTGACATTCAAGGAAGATTGGCCCAGTTCTGTGCGTCAG
GCAAATCAATGTTTTGATGCCCTCATCCGTCGGTGGCTTGTTTATCCTGCTGATATTGGT
GCCACAGGAAAGATCAAGAGCTGTGAAGTAGGTGATCTAGTTCATGGGTTCATTACCACA
ATTGCTAGAAAACAACACATTGTGGAGACACGCCTATCACATCACTTGGCTCGCCACTTC
TCCATTTTCAATGATCTCCGACTCCGCAGTTCCGATAGAATTCAAACGTTCTTCCAAAGC
CTCTCACAATCATCTCGAGTATCCCTACTGAAGGTTCTAGATCTAGAAGGTTGTCAGTGC
TTTGGTGTTAAGAATCAGAGGTACCTCAAGGACATCTGCAACAAGATGTTACTGCTCAAG
TATCTGAGCCTAAAGGGAACAAATATTACCCAACTGCCCAGAGAAATCAACTGCCTCCGT
GAGCTAGAGGTATTGGATATCCGAGAAACCATGGTGCCAGCAAATGCAACGGTTAATGTC
CTGCTCTTGAAGCTGAAGCGTCTACTTGCTGGTCACATTGACCCAAGTCTAAGAAATTTT
CGCACTAGCGTTCATATTCCTCACAGGATAGACAAGATGGTAAACATAGAGGTACTATCT
AATGTCAAGGCCCAGCGCAGTGATGATTTGGAAGATATTGGAAAGCTATGGCAGCTGAGG
AAGCTAGGTGTGGTTATTAATGCTAAGAAAAGTCACCTCGAGAAGTTGCTTAAAGCAATC
AGCGACCTACATGAGTGCATCCGTTCTCTGACAATCACTATTCCCACAACCACACTCGAG
GGTACTCCTTCAAACCCAGAGTTACCAGATCATATTGACTCTAACCTTCCCCATCCCAAG
AAACTTGAGAGTCTAAGCATCAGTGGAGCCAGGTATCTTTTTCCATTGTTGATCAAAAGT
GATAATAACAAGCTTGCCAAGGTAACTCTAAGTAGCACACAACTGAACCAAGATGATCTG
GAGGTCCTCGCCAAGCTACCCAAGTTACAGTGTGTTAGGCTCCGACACATTTCATGCACA
GAGAGCATGCTCATCTTCAAGAAAGATGATTTCAAATGTCTCAAGTACCTTCTTATTGAG
GGCTTTAACTTGACTAATATCACTTTTGAGAATAGATCAGCCTGTGAGCTCGAGAAGATG
GTTTTATCTTCCACCAGCATAGAGTCTATCTCTGGAGTTGATAGGCTTCCAAAATTCAAA
GAGCTTGAGTTGAACAACAGCCCTGTCCCGAATGAGGTGAAAGAAGCCATTGAAAACAAT
AAAAGGATAAATCTTAAATGTAATGAACCATGA

Protein

1291 aa

>Os11t0598500-00 NB-ARC domain containing protein.
MTELASGAVSSLLVVIRNEAALLGGVRDDVQFIKEEMESMHSFLGHLARSAPQGGEHDEQ
VCTWMKQVRLLAQDCNNCIDLYLYSGNPEIHRAKGRLRRHLWWAYWYLRKMVAQHRAAIQ
LCQLKDRARDVGERRMRYGVEVPATTKAAAPDAEGGYAAGDDEDYEDHSARRAVYEPPAL
EDYVNAKLLEWAEEIPPDAIETLSIAIVAPDTDNKEVLDLARDTLVVPGNYYHRSITVNV
PAVHADFLPLRPKEILYYILRELEPGSQKHVTYQGDPWQDYYNIYCGKKRVLHKIKRNIE
KMNVYKKLEKIKSDIKDGQHKSDKQLLLQLQKKGVDQVDLHVLVQLLLLQSQQDQANNKA
VDMYKLPEWNYDNIMKIARKLKKHMEADEELNEQISVEKRTTKQGGGGENKEEKDKGDGD
REEGKEENEKDKGEADGEGEQEEEMKDKEKGGEERKEEPHHEKQEHKKEKEVKEEERKEE
QNKEKEEREGTEEKQVGGGEKKEEKEDGDDDGVIDDNYDEEEEEEEEDDDPIHLHEAQYV
QILLEVFPKITSSKAQQQDKSEAKQATNTATTTLDEVRIKQMINDAKRDILRELRGGKSD
KNEATGEPDVPPDKNQPTGEHAGVPDQNGEACFEELELKIEEIKQELKEQLKIKGIVDKI
KHHLQGECPLIILKVDDMMDGSRWEEFRRALSLLECSADALIFTTESTEQAKGYCYPPRE
PIDHCSHVGLYHHTVLELTSKQKNKSNYDPRIFLDILKECEGHEFCMRIFTHAVYANPKK
STEELSKLHSTLQDSQKSFDAIAKNMLMYSYNDLPKEYKSCLLYLAIFPKGQKIRRSTLI
GRWVTEGLTFKEDWPSSVRQANQCFDALIRRWLVYPADIGATGKIKSCEVGDLVHGFITT
IARKQHIVETRLSHHLARHFSIFNDLRLRSSDRIQTFFQSLSQSSRVSLLKVLDLEGCQC
FGVKNQRYLKDICNKMLLLKYLSLKGTNITQLPREINCLRELEVLDIRETMVPANATVNV
LLLKLKRLLAGHIDPSLRNFRTSVHIPHRIDKMVNIEVLSNVKAQRSDDLEDIGKLWQLR
KLGVVINAKKSHLEKLLKAISDLHECIRSLTITIPTTTLEGTPSNPELPDHIDSNLPHPK
KLESLSISGARYLFPLLIKSDNNKLAKVTLSSTQLNQDDLEVLAKLPKLQCVRLRHISCT
ESMLIFKKDDFKCLKYLLIEGFNLTNITFENRSACELEKMVLSSTSIESISGVDRLPKFK
ELELNNSPVPNEVKEAIENNKRINLKCNEP*

CDS

chr11:22862447..22866319 (+ strand) : 3873 bp

FASTA

>Os11t0598500-00 class=Sequence position=chr11:22862447..22866319 (+ strand)
ATGACTGAGC TCGCTTCTGG CGCCGTGAGC TCACTGCTGG TGGTCATCCG CAACGAGGCG GCTCTTCTCG GCGGTGTCCG
GGACGACGTG CAGTTCATCA AGGAGGAGAT GGAGAGCATG CACAGCTTCC TGGGGCACCT GGCCAGGAGC GCTCCACAGG
GTGGCGAGCA CGATGAGCAG GTGTGTACAT GGATGAAACA GGTGCGGCTG CTCGCCCAGG ACTGCAACAA TTGCATCGAC
CTCTACCTGT ACTCTGGGAA TCCAGAGATT CACCGCGCCA AGGGCAGACT CCGGCGACAC CTCTGGTGGG CTTACTGGTA
CCTGCGCAAG ATGGTCGCGC AGCACCGCGC GGCCATCCAG CTATGCCAGC TCAAGGACCG GGCGCGGGAC GTCGGCGAGC
GACGGATGAG GTACGGCGTG GAGGTTCCAG CCACGACAAA GGCTGCTGCA CCTGACGCAG AAGGTGGCTA TGCTGCTGGA
GATGATGAAG ACTATGAGGA TCATTCTGCT CGAAGGGCCG TCTATGAGCC CCCCGCTCTG GAAGACTACG TGAACGCAAA
ACTATTGGAG TGGGCAGAAG AAATTCCTCC AGACGCCATT GAGACGTTGT CCATCGCCAT TGTGGCACCG GATACAGATA
ACAAGGAAGT CCTTGATCTT GCACGCGATA CTTTGGTTGT TCCAGGCAAC TACTACCATC GCAGTATCAC GGTCAACGTC
CCGGCGGTGC ACGCCGATTT TTTACCGCTA CGACCTAAGG AGATTCTCTA CTACATCTTA CGGGAGCTCG AGCCCGGATC
CCAGAAGCAC GTCACATATC AAGGTGACCC TTGGCAAGAT TACTACAATA TTTACTGTGG CAAAAAAAGG GTGCTTCATA
AAATCAAAAG GAATATAGAA AAGATGAATG TTTACAAGAA GCTTGAGAAG ATCAAGAGTG ATATTAAAGA TGGACAACAT
AAGAGTGACA AGCAGCTGCT GCTTCAACTA CAAAAGAAGG GTGTGGATCA GGTGGATCTA CATGTACTCG TTCAGCTATT
GCTGCTCCAG TCTCAACAAG ACCAAGCAAA CAACAAAGCA GTAGACATGT ATAAATTACC AGAGTGGAAC TACGATAACA
TCATGAAAAT AGCAAGGAAG CTTAAGAAGC ATATGGAAGC AGACGAGGAG CTTAATGAGC AAATTAGTGT AGAAAAGAGA
ACAACTAAGC AAGGAGGAGG AGGAGAGAAC AAGGAGGAGA AAGACAAAGG AGATGGAGAC AGAGAAGAGG GGAAGGAGGA
GAACGAGAAA GACAAAGGAG AAGCAGACGG AGAAGGAGAG CAGGAGGAGG AGATGAAGGA CAAGGAAAAA GGAGGAGAAG
AGAGGAAGGA GGAGCCGCAC CACGAGAAGC AGGAGCACAA GAAGGAAAAG GAAGTGAAAG AAGAAGAGAG GAAGGAGGAG
CAGAACAAGG AGAAAGAGGA GAGGGAAGGG ACAGAAGAAA AACAAGTAGG AGGAGGGGAG AAAAAAGAAG AAAAAGAAGA
CGGTGATGAT GATGGCGTCA TCGACGACAA TTACGATGAG GAGGAGGAGG AGGAGGAAGA AGATGACGAC CCGATTCATC
TTCATGAAGC TCAATACGTA CAAATTCTAC TAGAAGTGTT CCCAAAGATC ACCAGCAGCA AGGCCCAGCA GCAGGACAAA
TCAGAGGCCA AGCAAGCTAC AAACACCGCA ACGACTACAT TGGATGAGGT ACGAATCAAA CAAATGATCA ATGACGCAAA
ACGAGATATC TTAAGGGAGC TGCGGGGAGG CAAATCTGAT AAGAATGAAG CAACAGGAGA ACCTGATGTT CCACCTGATA
AGAATCAACC AACAGGTGAA CATGCAGGTG TTCCGGACCA AAATGGAGAG GCTTGTTTTG AAGAATTAGA GCTGAAGATC
GAAGAAATCA AGCAGGAACT TAAAGAGCAG CTGAAGATCA AAGGGATCGT GGACAAGATC AAACATCACT TACAGGGTGA
GTGCCCCCTC ATTATCCTAA AAGTTGATGA CATGATGGAT GGATCCAGAT GGGAGGAGTT CAGAAGGGCT TTGAGCCTAT
TAGAATGCAG TGCCGATGCA CTGATCTTCA CCACAGAGAG CACCGAACAG GCTAAAGGAT ATTGCTATCC ACCGCGAGAA
CCTATAGATC ACTGTTCTCA TGTTGGTCTC TACCATCATA CAGTGCTCGA ACTTACTAGC AAGCAGAAGA ATAAAAGCAA
CTATGACCCC CGGATTTTTC TTGACATCTT GAAGGAGTGT GAGGGGCATG AATTCTGCAT GAGGATCTTC ACCCATGCTG
TGTATGCTAA CCCCAAGAAG AGCACTGAAG AGTTAAGCAA GCTGCACAGC ACCCTGCAGG ATTCACAAAA ATCATTTGAC
GCAATAGCTA AGAATATGCT CATGTACTCT TACAATGATC TGCCTAAAGA ATACAAATCC TGCTTGTTGT ACCTAGCTAT
CTTCCCCAAG GGACAGAAGA TCAGGCGGTC AACCTTGATT GGACGGTGGG TTACAGAAGG GTTGACATTC AAGGAAGATT
GGCCCAGTTC TGTGCGTCAG GCAAATCAAT GTTTTGATGC CCTCATCCGT CGGTGGCTTG TTTATCCTGC TGATATTGGT
GCCACAGGAA AGATCAAGAG CTGTGAAGTA GGTGATCTAG TTCATGGGTT CATTACCACA ATTGCTAGAA AACAACACAT
TGTGGAGACA CGCCTATCAC ATCACTTGGC TCGCCACTTC TCCATTTTCA ATGATCTCCG ACTCCGCAGT TCCGATAGAA
TTCAAACGTT CTTCCAAAGC CTCTCACAAT CATCTCGAGT ATCCCTACTG AAGGTTCTAG ATCTAGAAGG TTGTCAGTGC
TTTGGTGTTA AGAATCAGAG GTACCTCAAG GACATCTGCA ACAAGATGTT ACTGCTCAAG TATCTGAGCC TAAAGGGAAC
AAATATTACC CAACTGCCCA GAGAAATCAA CTGCCTCCGT GAGCTAGAGG TATTGGATAT CCGAGAAACC ATGGTGCCAG
CAAATGCAAC GGTTAATGTC CTGCTCTTGA AGCTGAAGCG TCTACTTGCT GGTCACATTG ACCCAAGTCT AAGAAATTTT
CGCACTAGCG TTCATATTCC TCACAGGATA GACAAGATGG TAAACATAGA GGTACTATCT AATGTCAAGG CCCAGCGCAG
TGATGATTTG GAAGATATTG GAAAGCTATG GCAGCTGAGG AAGCTAGGTG TGGTTATTAA TGCTAAGAAA AGTCACCTCG
AGAAGTTGCT TAAAGCAATC AGCGACCTAC ATGAGTGCAT CCGTTCTCTG ACAATCACTA TTCCCACAAC CACACTCGAG
GGTACTCCTT CAAACCCAGA GTTACCAGAT CATATTGACT CTAACCTTCC CCATCCCAAG AAACTTGAGA GTCTAAGCAT
CAGTGGAGCC AGGTATCTTT TTCCATTGTT GATCAAAAGT GATAATAACA AGCTTGCCAA GGTAACTCTA AGTAGCACAC
AACTGAACCA AGATGATCTG GAGGTCCTCG CCAAGCTACC CAAGTTACAG TGTGTTAGGC TCCGACACAT TTCATGCACA
GAGAGCATGC TCATCTTCAA GAAAGATGAT TTCAAATGTC TCAAGTACCT TCTTATTGAG GGCTTTAACT TGACTAATAT
CACTTTTGAG AATAGATCAG CCTGTGAGCT CGAGAAGATG GTTTTATCTT CCACCAGCAT AGAGTCTATC TCTGGAGTTG
ATAGGCTTCC AAAATTCAAA GAGCTTGAGT TGAACAACAG CCCTGTCCCG AATGAGGTGA AAGAAGCCAT TGAAAACAAT
AAAAGGATAA ATCTTAAATG TAATGAACCA TGA