Os11t0602200-01

Locus

Os11g0602200

Description

Similar to SET domain protein SDG111.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET41, SDG704, OsSUVH1

Oryzabase Gene Name Synonym(s)

SET protein 41, SUVH Histone Methyltransferase 1

Transcript Evidence

AK102379 (DDBJ, Best hit)

Protein Evidence

Q9AT64 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Molecular Function: histone binding (GO:0042393)

Functional domain (InterPro)

SET domain (IPR001214)

SRA-YDG (IPR003105)

Post-SET domain (IPR003616)

Pre-SET domain (IPR007728)

AT hook, DNA-binding motif (IPR017956)

AT hook-like (IPR020478)

Full-length cDNA

J033092A08 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0602200-01)

RiceXPro (AK102379)

Others

Oryzabase (13404)

KEGG (Os11t0602200-01)

Transcript

3269 bp

>Os11t0602200-01 Similar to SET domain protein SDG111.
TGCCTCTCTTCTCACCGTGCCAAAACCCTAGAGCTCTCCTCCCTCCTCTGTACTCACCTT
CCGGCGGCGCACCAGGCGGGCTCGAGGGCGGAGTGGGAGACGGGCGGCGACTCCGGGCGG
CCGCGGGCGGCGGCGAGGGCGGGGACTCTCCTGGCGGCCCAGTCGGCAAGGACGTAGGGG
GCAGCGAGCAGACCAATTTTTTCTCCTTCCACTCCTCTTCAAATCAAGTTGGTTAGCTCA
AGATCTGTGATGAACGACCAAGCTTCCTTTTAGATCTTCTGTTTATTCTCCTTGCTTAAC
CTAAACTATGACTGGTAAACAAACCTAGAGAAGATACAAAGGAAATAACGGCATAAACTT
TTGTTTTGCAAAAGATTAACAGTGGCTTACCATGGCTGGAACTCGGCAGACAACTTCAGT
TCCGATGGATAATGCAGCAGTTGTTGATGCAAAACCCTTGCGCACATTGACTCCCATGTT
CCCTGCGGCACTTGGTCTGCACACTTTCACTGCTAAAGAAAACTCATCTTCGATTGTCTG
TATTACCCCGTTTGGACCATATGCTGGGGGCACTGAACAGGCAATGCCTGCTAGTATTCC
ACCAATGTTTGCATCACCGGCTGCCCCTGCAGACCCCAACCAGAGGCAGCCATATGCTGT
TCACTTGAATGGAGCTGCTCCTGCTAACGGTACAGCAAACAACACAGGGGTCATCCCTGA
TTTGCAAATAGCTGTGGCAGGTACAGTGGAATCTGCTAAGAGGAAGAGGGGCAGACCCAA
GCGCGTGCAAGATTCTTCTGTTCCTTCAGCTCATTTGGTTCCTTCAGCTCCAGGAGGTAA
CATCACTGCTGTCCAGACGCCTCCTTCAGCAACCACAGATGAATCTGGTAAGAAGAAGAG
GGGACGGCCCAAGCGGGTACAAGATGTACCTGTCCTGTCAACTCCTTCAGCTCCTCAGGT
AGATAGTACAGTTTTTCAGACACCTGCTTCTGCTGTAAATGAATCTGTTACGAGGAAAAG
GGGACGACCCAGGCGTGTACAGGATGGTGCAGATACTTCAGCTCCTCCAATTCAATCAAA
ATATAATGAGCCTGTTTTGCAGACACCTTCTGCTGTCACCTTACCAGAAGATGGTAAGAG
GAAGAGAGGGCGGCCAAAGCGTGTGCCTGATGGTGCACTGATTCCTTTAAGTCACTCAGG
TGTTTCGATAGATGATGACAGTGGTGAAATAATAACAGGGAAACGTGGACGGCCTAGGAA
AATTGATGTCAATCTTCTGAATCTGCCATCTTTGTTTTCAGATGATCCTAGGGAATCTGT
TGATAATGTACTCATGATGTTTGATGCACTGCGGCGGAGGCTCATGCAGTTGGATGAGGT
GAAGCAAGGAGCAAAGCAGCAACATAACTTAAAGGCCGGGAGTATCATGATGAGTGCTGA
ACTTCGTGCAAATAAGAACAAGAGGATTGGAGAGGTTCCAGGTGTCGAGGTTGGTGATAT
GTTCTACTTCAGAATAGAGATGTGTCTGGTTGGACTGAATAGTCAGAGCATGTCTGGGAT
TGATTACATGTCTGCTAAGTTTGGTAATGAGGAGGATCCTGTGGCTATCAGTATCGTGTC
AGCTGGTGTGTATGAGAATACCGAAGATGACCCAGATGTGCTGGTTTACACTGGACAGGG
CATGTCTGGAAAGGATGACCAAAAGCTTGAAAGAGGTAATCTTGCACTTGAAAGGAGTTT
GCATAGAGGTAATCAAATCAGAGTTGTTCGTAGTGTAAGAGATTTGACTTGTCCTACTGG
TAAGATATACATTTATGATGGCCTTTATAAAATAAGAGAAGCATGGGTGGAGAAAGGAAA
AACTGGCTTTAATGTGTTTAAACACAAGCTGCTCAGAGAACCTGGTCAACCTGATGGCAT
AGCAGTGTGGAAGAAGACTGAAAAATGGAGGGAGAATCCTTCCTCTCGAGACCATGTTAT
ATTGCGTGACATATCATATGGTGCAGAAAGCAAGCCTGTTTGCCTTGTGAATGAAGTGGA
TGATGAGAAAGGTCCTAGCCACTTCAACTACACAACTAAACTGAACTACAGGAATTCTCT
CAGCTCAATGAGAAAGATGCAAGGCTGCAATTGCGCAAGTGTGTGCCTTCCTGGTGATAA
CAACTGCTCTTGCACTCATCGAAATGCCGGTGATCTTCCATACAGTGCTTCAGGCATACT
TGTTAGCCGGATGCCTATGCTGTATGAGTGTAACGATTCCTGTACATGCTCACATAATTG
CCGGAACCGAGTTGTACAGAAAGGTTCTCAGATCCACTTTGAGGTGTTTAAGACAGGAGA
TCGAGGTTGGGGACTTCGTAGTTGGGATCCAATTCGGGCAGGCACATTTATTTGTGAATA
TGCAGGAGAAGTTATTGACAGAAACAGTATCATTGGAGAAGATGATTACATCTTTGAGAC
ACCGTCTTCTGAGCAGAATTTAAGATGGAACTATGCACCAGAATTACTGGGTGAACCCAG
TCTTTCTGACTCAAGTGAGACACCTAAGCAACTGCCAATAATTATCAGTGCAAAACGAAC
TGGAAACATAGCTCGCTTTATGAACCACAGCTGCTCACCAAATGTTTTTTGGCAACCAGT
TTTGTATGATCATGGTGACGAGGGATATCCACATATCGCATTCTTTGCAATCAAGCATAT
TCCTCCGATGACAGAGCTTACATATGATTATGGTCAGAGCCAGGGTAATGTTCAACTGGG
AATCAATTCTGGATGTCGGAAGTCCAAAAACTGCTTATGTTGGTCTCGCAAGTGCAGAGG
TTCCTTTGGCTAAAATGCGAACCCTGCAACAAAAACATTAAAGCATAATCTGCCATTGCA
AGAAGTAGGCGATTGTTGTAGAACTATGAAGCAGCAGGGTGCATTCAGTGTTTCAAGATG
CCATGTAATAAGGTTGGCCTTCGTCTGGATGAGAATGCAAAAGAGGGTATTTATTGCAGA
AAGCATTGGCATTGTACCAAACTTTATTGGAATAACTAGTATTTAGCGTAGCATCTGAAT
TCCGAGAAGGTTGGAACCGTGTTACTATGTTCTTGTAGTGTAGTTGTTTCTCCTGTTTAA
GAGAACTTTACCAACTGTAGAATGCCATGCATATGGTTGCATCGCAAGATTTTCCTGGGC
TTCGCATGCCAGTCGTGCACTCGCCGTATGTTTTTCTGTAATATTAATGGCTACATAATG
CATCCTGTAATAATCATGGTAGTAGCTCC

CDS

2442 bp

>Os11t0602200-01 Similar to SET domain protein SDG111.
ATGGCTGGAACTCGGCAGACAACTTCAGTTCCGATGGATAATGCAGCAGTTGTTGATGCA
AAACCCTTGCGCACATTGACTCCCATGTTCCCTGCGGCACTTGGTCTGCACACTTTCACT
GCTAAAGAAAACTCATCTTCGATTGTCTGTATTACCCCGTTTGGACCATATGCTGGGGGC
ACTGAACAGGCAATGCCTGCTAGTATTCCACCAATGTTTGCATCACCGGCTGCCCCTGCA
GACCCCAACCAGAGGCAGCCATATGCTGTTCACTTGAATGGAGCTGCTCCTGCTAACGGT
ACAGCAAACAACACAGGGGTCATCCCTGATTTGCAAATAGCTGTGGCAGGTACAGTGGAA
TCTGCTAAGAGGAAGAGGGGCAGACCCAAGCGCGTGCAAGATTCTTCTGTTCCTTCAGCT
CATTTGGTTCCTTCAGCTCCAGGAGGTAACATCACTGCTGTCCAGACGCCTCCTTCAGCA
ACCACAGATGAATCTGGTAAGAAGAAGAGGGGACGGCCCAAGCGGGTACAAGATGTACCT
GTCCTGTCAACTCCTTCAGCTCCTCAGGTAGATAGTACAGTTTTTCAGACACCTGCTTCT
GCTGTAAATGAATCTGTTACGAGGAAAAGGGGACGACCCAGGCGTGTACAGGATGGTGCA
GATACTTCAGCTCCTCCAATTCAATCAAAATATAATGAGCCTGTTTTGCAGACACCTTCT
GCTGTCACCTTACCAGAAGATGGTAAGAGGAAGAGAGGGCGGCCAAAGCGTGTGCCTGAT
GGTGCACTGATTCCTTTAAGTCACTCAGGTGTTTCGATAGATGATGACAGTGGTGAAATA
ATAACAGGGAAACGTGGACGGCCTAGGAAAATTGATGTCAATCTTCTGAATCTGCCATCT
TTGTTTTCAGATGATCCTAGGGAATCTGTTGATAATGTACTCATGATGTTTGATGCACTG
CGGCGGAGGCTCATGCAGTTGGATGAGGTGAAGCAAGGAGCAAAGCAGCAACATAACTTA
AAGGCCGGGAGTATCATGATGAGTGCTGAACTTCGTGCAAATAAGAACAAGAGGATTGGA
GAGGTTCCAGGTGTCGAGGTTGGTGATATGTTCTACTTCAGAATAGAGATGTGTCTGGTT
GGACTGAATAGTCAGAGCATGTCTGGGATTGATTACATGTCTGCTAAGTTTGGTAATGAG
GAGGATCCTGTGGCTATCAGTATCGTGTCAGCTGGTGTGTATGAGAATACCGAAGATGAC
CCAGATGTGCTGGTTTACACTGGACAGGGCATGTCTGGAAAGGATGACCAAAAGCTTGAA
AGAGGTAATCTTGCACTTGAAAGGAGTTTGCATAGAGGTAATCAAATCAGAGTTGTTCGT
AGTGTAAGAGATTTGACTTGTCCTACTGGTAAGATATACATTTATGATGGCCTTTATAAA
ATAAGAGAAGCATGGGTGGAGAAAGGAAAAACTGGCTTTAATGTGTTTAAACACAAGCTG
CTCAGAGAACCTGGTCAACCTGATGGCATAGCAGTGTGGAAGAAGACTGAAAAATGGAGG
GAGAATCCTTCCTCTCGAGACCATGTTATATTGCGTGACATATCATATGGTGCAGAAAGC
AAGCCTGTTTGCCTTGTGAATGAAGTGGATGATGAGAAAGGTCCTAGCCACTTCAACTAC
ACAACTAAACTGAACTACAGGAATTCTCTCAGCTCAATGAGAAAGATGCAAGGCTGCAAT
TGCGCAAGTGTGTGCCTTCCTGGTGATAACAACTGCTCTTGCACTCATCGAAATGCCGGT
GATCTTCCATACAGTGCTTCAGGCATACTTGTTAGCCGGATGCCTATGCTGTATGAGTGT
AACGATTCCTGTACATGCTCACATAATTGCCGGAACCGAGTTGTACAGAAAGGTTCTCAG
ATCCACTTTGAGGTGTTTAAGACAGGAGATCGAGGTTGGGGACTTCGTAGTTGGGATCCA
ATTCGGGCAGGCACATTTATTTGTGAATATGCAGGAGAAGTTATTGACAGAAACAGTATC
ATTGGAGAAGATGATTACATCTTTGAGACACCGTCTTCTGAGCAGAATTTAAGATGGAAC
TATGCACCAGAATTACTGGGTGAACCCAGTCTTTCTGACTCAAGTGAGACACCTAAGCAA
CTGCCAATAATTATCAGTGCAAAACGAACTGGAAACATAGCTCGCTTTATGAACCACAGC
TGCTCACCAAATGTTTTTTGGCAACCAGTTTTGTATGATCATGGTGACGAGGGATATCCA
CATATCGCATTCTTTGCAATCAAGCATATTCCTCCGATGACAGAGCTTACATATGATTAT
GGTCAGAGCCAGGGTAATGTTCAACTGGGAATCAATTCTGGATGTCGGAAGTCCAAAAAC
TGCTTATGTTGGTCTCGCAAGTGCAGAGGTTCCTTTGGCTAA

Protein

814 aa

>Os11t0602200-01 Similar to SET domain protein SDG111.
MAGTRQTTSVPMDNAAVVDAKPLRTLTPMFPAALGLHTFTAKENSSSIVCITPFGPYAGG
TEQAMPASIPPMFASPAAPADPNQRQPYAVHLNGAAPANGTANNTGVIPDLQIAVAGTVE
SAKRKRGRPKRVQDSSVPSAHLVPSAPGGNITAVQTPPSATTDESGKKKRGRPKRVQDVP
VLSTPSAPQVDSTVFQTPASAVNESVTRKRGRPRRVQDGADTSAPPIQSKYNEPVLQTPS
AVTLPEDGKRKRGRPKRVPDGALIPLSHSGVSIDDDSGEIITGKRGRPRKIDVNLLNLPS
LFSDDPRESVDNVLMMFDALRRRLMQLDEVKQGAKQQHNLKAGSIMMSAELRANKNKRIG
EVPGVEVGDMFYFRIEMCLVGLNSQSMSGIDYMSAKFGNEEDPVAISIVSAGVYENTEDD
PDVLVYTGQGMSGKDDQKLERGNLALERSLHRGNQIRVVRSVRDLTCPTGKIYIYDGLYK
IREAWVEKGKTGFNVFKHKLLREPGQPDGIAVWKKTEKWRENPSSRDHVILRDISYGAES
KPVCLVNEVDDEKGPSHFNYTTKLNYRNSLSSMRKMQGCNCASVCLPGDNNCSCTHRNAG
DLPYSASGILVSRMPMLYECNDSCTCSHNCRNRVVQKGSQIHFEVFKTGDRGWGLRSWDP
IRAGTFICEYAGEVIDRNSIIGEDDYIFETPSSEQNLRWNYAPELLGEPSLSDSSETPKQ
LPIIISAKRTGNIARFMNHSCSPNVFWQPVLYDHGDEGYPHIAFFAIKHIPPMTELTYDY
GQSQGNVQLGINSGCRKSKNCLCWSRKCRGSFG*

5'UTR

chr11:23158472..23158699 (+ strand) : 228 bp

chr11:23160267..23160332 (+ strand) : 66 bp

chr11:23160435..23160531 (+ strand) : 97 bp

CDS

chr11:23160532..23162973 (+ strand) : 2442 bp

3'UTR

chr11:23162974..23163022 (+ strand) : 49 bp

chr11:23163823..23164209 (+ strand) : 387 bp

FASTA

>Os11t0602200-01 class=Sequence position=chr11:23158472..23164209 (+ strand)
TGCCTCTCTT CTCACCGTGC CAAAACCCTA GAGCTCTCCT CCCTCCTCTG TACTCACCTT CCGGCGGCGC ACCAGGCGGG
CTCGAGGGCG GAGTGGGAGA CGGGCGGCGA CTCCGGGCGG CCGCGGGCGG CGGCGAGGGC GGGGACTCTC CTGGCGGCCC
AGTCGGCAAG GACGTAGGGG GCAGCGAGCA GACCAATTTT TTCTCCTTCC ACTCCTCTTC AAATCAAGGT ATACTACAAA
TCTGAGCATA CTACTTGTAT TTTGGGGATT GATTTGTTCA GATCTGAGTG CTATAGTAGT TTCTAAGCTT GTGCATGAAT
GCCTGATAGT GCTAGAGTTG CCTTTTTTTT TTGATATTTT GTTCAGATCT GAGTGCTATA TGTTGTATGT CTCAATATAT
GTGTGTAtgg atgtggtaga cctgatttcg tatcaaactt tggcattgta gatggacagg tttctggttt atgcggctgc
atcgtatttg ttgttgtcaa tgatggctgt ggttatcgag tctagaaaaa agaaaaggaa aagggttcca aggagagaag
ggattaccta tgggccaatA GATGAAGGTG GTTTGGATTG ATTGAACTGA GCCTCACCAC ATCCTTCCAT GGCCGCACGC
CCGTCGCTGG ATGGGGATCA TGGATGGGTA GGTAGCTTGC CGAGGGTTTC GTATGCATGG AACGGGGAGG GGTTTTGCGA
TTGAGCTAAT GTAAGGGCAA TCGTTGCGAC TCTTTCGGTG CTTTGTTTGT AGGTTTTTAT ATTTATGTGT GTTAATGTAG
GAGATTGGTT TTGGCCATTA ATGTGCTTAG GGGATAAGGC GACGACATGC CCCTCCGTGG GCTGTTCTCG CGCCATATGT
ATTTATTTAT GGGGGGAGGC AGGCAATGTT TCTTGCTTAG CCCCCTTTAA GAGTTGGAAT AACATAATTG GAATCCTTGG
ATCGGATGAC AAGAATGGAT AGAGACAAAC GGAATTAGCT AATAAAGTGG GTATGGTGCC CAATAGCGAA ACACTACCAT
CAGTTATAGC TGTGATGATA TGTCAGCGCG GTAGCACACA CTGGTATGGC GGTTCGACTC CAGTGATGCG TGGGGACGGT
TTCACTCTTC ATGGCTTTTA TTGCATCATG TGTCCAATAG GGGCCATTGG CTGTGATTCT ATCTAGTATG CTGCTATGAG
ACAAATATTT AAATGTGTTC TGTTGCGCTC ATCTCATAGT CGACAAAATA GAGTGTGGGT AAAAGACACC TACATTAGTT
GTCACGGGAA GGTGCAACCC CCTTCCCGCT ATTGTGCTTA TACACTACCG AAGTGCATGC CTAGTGACCC TCCTTGTGCT
GATTCGCTAT CTTTGCCATC CTGTAAATGC ATGGCTATCT TGTTCCTTTT CCCTTCTAGA AAGTGATTTT TTTATCAAAT
GACTCTAATC TATAGCAGTC ACAAGGTGTT ATTCTCAGGA AACTTTTGGT TTTCTTAAAT GATCTAATTA TTAACAAGCA
TCATTATTCT TTGTTTTACA TGCAAAATGG TCTCCACCCA TCTAATTATC AACAAGTGTC GTTATTATTA TTTCTATTTT
TAACTTGTTG CGACAAAATA GGAATCTGTT TCTAATCTTA GCTTCATGTA AAATATCTAT TCAATCTCTT CCGCTAGTTG
ATAATCTTCT AATGGGATGT TCTATTGATT TAGTCTTTGC ATGTTGATTT TTATCATGCT TTAGTAATTC TTAGTCTTCT
CATATCGATG TTTACACATA TCTCTTGTGT TGCAGTTGGT TAGCTCAAGA TCTGTGATGA ACGACCAAGC TTCCTTTTAG
ATCTTCTGTT TATTCTCCTT GGTCAGTAAA ACAGATGACT TAAAAAATGC TGCATTAAAT AAACATAGCT TTAATTTCTT
GCTCAATTGT ATACTGATAG GTCTCCTTTT TACCCCTATC CAGCTTAACC TAAACTATGA CTGGTAAACA AACCTAGAGA
AGATACAAAG GAAATAACGG CATAAACTTT TGTTTTGCAA AAGATTAACA GTGGCTTACC ATGGCTGGAA CTCGGCAGAC
AACTTCAGTT CCGATGGATA ATGCAGCAGT TGTTGATGCA AAACCCTTGC GCACATTGAC TCCCATGTTC CCTGCGGCAC
TTGGTCTGCA CACTTTCACT GCTAAAGAAA ACTCATCTTC GATTGTCTGT ATTACCCCGT TTGGACCATA TGCTGGGGGC
ACTGAACAGG CAATGCCTGC TAGTATTCCA CCAATGTTTG CATCACCGGC TGCCCCTGCA GACCCCAACC AGAGGCAGCC
ATATGCTGTT CACTTGAATG GAGCTGCTCC TGCTAACGGT ACAGCAAACA ACACAGGGGT CATCCCTGAT TTGCAAATAG
CTGTGGCAGG TACAGTGGAA TCTGCTAAGA GGAAGAGGGG CAGACCCAAG CGCGTGCAAG ATTCTTCTGT TCCTTCAGCT
CATTTGGTTC CTTCAGCTCC AGGAGGTAAC ATCACTGCTG TCCAGACGCC TCCTTCAGCA ACCACAGATG AATCTGGTAA
GAAGAAGAGG GGACGGCCCA AGCGGGTACA AGATGTACCT GTCCTGTCAA CTCCTTCAGC TCCTCAGGTA GATAGTACAG
TTTTTCAGAC ACCTGCTTCT GCTGTAAATG AATCTGTTAC GAGGAAAAGG GGACGACCCA GGCGTGTACA GGATGGTGCA
GATACTTCAG CTCCTCCAAT TCAATCAAAA TATAATGAGC CTGTTTTGCA GACACCTTCT GCTGTCACCT TACCAGAAGA
TGGTAAGAGG AAGAGAGGGC GGCCAAAGCG TGTGCCTGAT GGTGCACTGA TTCCTTTAAG TCACTCAGGT GTTTCGATAG
ATGATGACAG TGGTGAAATA ATAACAGGGA AACGTGGACG GCCTAGGAAA ATTGATGTCA ATCTTCTGAA TCTGCCATCT
TTGTTTTCAG ATGATCCTAG GGAATCTGTT GATAATGTAC TCATGATGTT TGATGCACTG CGGCGGAGGC TCATGCAGTT
GGATGAGGTG AAGCAAGGAG CAAAGCAGCA ACATAACTTA AAGGCCGGGA GTATCATGAT GAGTGCTGAA CTTCGTGCAA
ATAAGAACAA GAGGATTGGA GAGGTTCCAG GTGTCGAGGT TGGTGATATG TTCTACTTCA GAATAGAGAT GTGTCTGGTT
GGACTGAATA GTCAGAGCAT GTCTGGGATT GATTACATGT CTGCTAAGTT TGGTAATGAG GAGGATCCTG TGGCTATCAG
TATCGTGTCA GCTGGTGTGT ATGAGAATAC CGAAGATGAC CCAGATGTGC TGGTTTACAC TGGACAGGGC ATGTCTGGAA
AGGATGACCA AAAGCTTGAA AGAGGTAATC TTGCACTTGA AAGGAGTTTG CATAGAGGTA ATCAAATCAG AGTTGTTCGT
AGTGTAAGAG ATTTGACTTG TCCTACTGGT AAGATATACA TTTATGATGG CCTTTATAAA ATAAGAGAAG CATGGGTGGA
GAAAGGAAAA ACTGGCTTTA ATGTGTTTAA ACACAAGCTG CTCAGAGAAC CTGGTCAACC TGATGGCATA GCAGTGTGGA
AGAAGACTGA AAAATGGAGG GAGAATCCTT CCTCTCGAGA CCATGTTATA TTGCGTGACA TATCATATGG TGCAGAAAGC
AAGCCTGTTT GCCTTGTGAA TGAAGTGGAT GATGAGAAAG GTCCTAGCCA CTTCAACTAC ACAACTAAAC TGAACTACAG
GAATTCTCTC AGCTCAATGA GAAAGATGCA AGGCTGCAAT TGCGCAAGTG TGTGCCTTCC TGGTGATAAC AACTGCTCTT
GCACTCATCG AAATGCCGGT GATCTTCCAT ACAGTGCTTC AGGCATACTT GTTAGCCGGA TGCCTATGCT GTATGAGTGT
AACGATTCCT GTACATGCTC ACATAATTGC CGGAACCGAG TTGTACAGAA AGGTTCTCAG ATCCACTTTG AGGTGTTTAA
GACAGGAGAT CGAGGTTGGG GACTTCGTAG TTGGGATCCA ATTCGGGCAG GCACATTTAT TTGTGAATAT GCAGGAGAAG
TTATTGACAG AAACAGTATC ATTGGAGAAG ATGATTACAT CTTTGAGACA CCGTCTTCTG AGCAGAATTT AAGATGGAAC
TATGCACCAG AATTACTGGG TGAACCCAGT CTTTCTGACT CAAGTGAGAC ACCTAAGCAA CTGCCAATAA TTATCAGTGC
AAAACGAACT GGAAACATAG CTCGCTTTAT GAACCACAGC TGCTCACCAA ATGTTTTTTG GCAACCAGTT TTGTATGATC
ATGGTGACGA GGGATATCCA CATATCGCAT TCTTTGCAAT CAAGCATATT CCTCCGATGA CAGAGCTTAC ATATGATTAT
GGTCAGAGCC AGGGTAATGT TCAACTGGGA ATCAATTCTG GATGTCGGAA GTCCAAAAAC TGCTTATGTT GGTCTCGCAA
GTGCAGAGGT TCCTTTGGCT AAAATGCGAA CCCTGCAACA AAAACATTAA AGCATAATCT GCCATTGCAA GGTGAGTCAT
TGGATGTTTT CTCATTTCGT CACCGACAGT ACTATTTTTT CTTGAAAATT GCATGTTCTT ATTTGTGACA ATTATACTTT
CTTTACTATG TTATGGAGTT CATGGCTAGA TACTTGGTAC TTTGGAGGGT GCATAGTGTT CCACCTTTTG AACTGGTTGA
TGGATTGGAA TTTCCAAATA AAAATGGAGT TAAGTAATTT AGTGCCTTCC AGCAAAATGA AGTTGTTATA GCTGGTTCTT
ATTCATTTAA GTGAAGTCAG AACTCACAAC TTCTGTGAGT TGAAGGCTGC TCCTTCACAT TCGCTACGAA ATTTTACTCG
CGAACTGTGA TTTAGCCTGT GTTTCCTGTA CTACTATAGA TTTATATACT GTTATAAGCG GCCAACATGG AAAACTTGGT
AAATGGAAAT TATTTGAAAA ACATATACAC ATTAGTTTTG TGCATACATA TAGTTGAATC ACAAAATATT TGTTCATGAG
TACCACTATC CATTTTGAAC TTTCTAGCGT TGAACACAAA TAATATGACC AGAAGCAACA TAATGTTATG TAAATGTATT
TATACCATGA AGTATCTTCA GTACCTTTCT AAAAGCCTGG CCCTCCTTAC GTCATATTCT TATTACTGAG CATATTTTCT
TTAATTTTTT TAAAGTTTAC ATCACTGTCA ACACAATAAA AGCTAAATAT CTCCTTTTTG GCACATTTTG CCTGTAGATC
CATGTCGATT AACAGATATT GGCAATGTAT TCCATCTCCA TTCTGACAAA TTGAACTGTC CTTACCTACA GAAGTAGGCG
ATTGTTGTAG AACTATGAAG CAGCAGGGTG CATTCAGTGT TTCAAGATGC CATGTAATAA GGTTGGCCTT CGTCTGGATG
AGAATGCAAA AGAGGGTATT TATTGCAGAA AGCATTGGCA TTGTACCAAA CTTTATTGGA ATAACTAGTA TTTAGCGTAG
CATCTGAATT CCGAGAAGGT TGGAACCGTG TTACTATGTT CTTGTAGTGT AGTTGTTTCT CCTGTTTAAG AGAACTTTAC
CAACTGTAGA ATGCCATGCA TATGGTTGCA TCGCAAGATT TTCCTGGGCT TCGCATGCCA GTCGTGCACT CGCCGTATGT
TTTTCTGTAA TATTAATGGC TACATAATGC ATCCTGTAAT AATCATGGTA GTAGCTCC

Locus: Os11g0602200

Loading...

Locus: Os11g0602200

Loading...