Os11t0602200-02

Locus

Os11g0602200

Description

Similar to SET1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET41, SDG704, OsSUVH1

Oryzabase Gene Name Synonym(s)

SET protein 41, SUVH Histone Methyltransferase 1

Transcript Evidence

AK059336 (DDBJ, Best hit)

Protein Evidence

Q9AT64 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Molecular Function: histone binding (GO:0042393)

Functional domain (InterPro)

SET domain (IPR001214)

SRA-YDG (IPR003105)

Pre-SET zinc-binding sub-group (IPR003606)

Pre-SET domain (IPR007728)

Full-length cDNA

001-026-A12 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0602200-02)

RiceXPro (AK059336)

Others

Oryzabase (13404)

KEGG (Os11t0602200-02 (EC:2.1.1.43))

Transcript

1858 bp

>Os11t0602200-02 Similar to SET1.
TTGTTTTCAGATGATCCTAGGGAATCTGTTGATAATGTACTCATGATGTTTGATGCACTG
CGGCGGAGGCTCATGCAGTTGGATGAGGTGAAGCAAGGAGCAAAGCAGCAACATAACTTA
AAGGCCGGGAGTATCATGATGAGTGCTGAACTTCGTGCAAATAAGAACAAGAGGATTGGA
GAGGTTCCAGGTGTCGAGGTTGGTGATATGTTCTACTTCAGAATAGAGATGTGTCTGGTT
GGACTGAATAGTCAGAGCATGTCTGGGATTGATTACATGTCTGCTAAGTTTGGTAATGAG
GAGGATCCTGTGGCTATCAGTATCGTGTCAGCTGGTGTGTATGAGAATACCGAAGATGAC
CCAGATGTGCTGGTTTACACTGGACAGGGCATGTCTGGAAAGGATGACCAAAAGCTTGAA
AGAGGTAATCTTGCACTTGAAAGGAGTTTGCATAGAGGTAATCAAATCAGAGTTGTTCGT
AGTGTAAGAGATTTGACTTGTCCTACTGGTAAGATATACATTTATGATGGCCTTTATAAA
ATAAGAGAAGCATGGGTGGAGAAAGGAAAAACTGGCTTTAATGTGTTTAAACACAAGCTG
CTCAGAGAACCTGGTCAACCTGATGGCATAGCAGTGTGGAAGAAGACTGAAAAATGGAGG
GAGAATCCTTCCTCTCGAGACCATGTTATATTGCGTGACATATCATATGGTGCAGAAAGC
AAGCCTGTTTGCCTTGTGAATGAAGTGGATGATGAGAAAGGTCCTAGCCACTTCAACTAC
ACAACTAAACTGAACTACAGGAATTCTCTCAGCTCAATGAGAAAGATGCAAGGCTGCAAT
TGCGCAAGTGTGTGCCTTCCTGGTGATAACAACTGCTCTTGCACTCATCGAAATGCCGGT
GATCTTCCATACAGTGCTTCAGGCATACTTGTTAGCCGGATGCCTATGCTGTATGAGTGT
AACGATTCCTGTACATGCTCACATAATTGCCGGAACCGAGTTGTACAGAAAGGTTCTCAG
ATCCACTTTGAGGTGTTTAAGACAGGAGATCGAGGTTGGGGACTTCGTAGTTGGGATCCA
ATTCGGGCAGGCACATTTATTTGTGAATATGCAGGAGAAGTTATTGACAGAAACAGTATC
ATTGGAGAAGATGATTACATCTTTGAGACACCGTCTTCTGAGCAGAATTTAAGATGGAAC
TATGCACCAGAATTACTGGGTGAACCCAGTCTTTCTGACTCAAGTGAGACACCTAAGCAA
CTGCCAATAATTATCAGTGCAAAACGAACTGGAAACATAGCTCGCTTTATGAACCACAGC
TGCTCACCAAATGTTTTTTGGCAACCAGTTTTGTATGATCATGGTGACGAGGGATATCCA
CATATCGCATTCTTTGCAATCAAGCATATTCCTCCGATGACAGAGCTTACATATGATTAT
GGTCAGAGCCAGGGTAATGTTCAACTGGGAATCACTATGAAGCAGCAGGGTGCATTCAGT
GTTTCAAGATGCCATGTAATAAGGTTGGCCTTCGTCTGGATGAGAATGCAAAAGAGGGTA
TTTATTGCAGAAAGCATTGGCATTGTACCAAACTTTATTGGAATAACTAGTATTTAGCGT
AGCATCTGAATTCCGAGAAGGTTGGAACCGTGTTACTATGTTCTTGTAGTGTAGTTGTTT
CTCCTGTTTAAGAGAACTTTACCAACTGTAGAATGCCATGCATATGGTTGCATCGCAAGA
TTTTCCTGGGCTTCGCATGCCAGTCGTGCACTCGCCGTATGTTTTTCTGTAATATTAATG
GCTACATAATGCATCCTGTAATAATCATGGTAGTAGCTCCAGTCATCTGCTGAGGTTG

CDS

1617 bp

>Os11t0602200-02 Similar to SET1.
TTGTTTTCAGATGATCCTAGGGAATCTGTTGATAATGTACTCATGATGTTTGATGCACTG
CGGCGGAGGCTCATGCAGTTGGATGAGGTGAAGCAAGGAGCAAAGCAGCAACATAACTTA
AAGGCCGGGAGTATCATGATGAGTGCTGAACTTCGTGCAAATAAGAACAAGAGGATTGGA
GAGGTTCCAGGTGTCGAGGTTGGTGATATGTTCTACTTCAGAATAGAGATGTGTCTGGTT
GGACTGAATAGTCAGAGCATGTCTGGGATTGATTACATGTCTGCTAAGTTTGGTAATGAG
GAGGATCCTGTGGCTATCAGTATCGTGTCAGCTGGTGTGTATGAGAATACCGAAGATGAC
CCAGATGTGCTGGTTTACACTGGACAGGGCATGTCTGGAAAGGATGACCAAAAGCTTGAA
AGAGGTAATCTTGCACTTGAAAGGAGTTTGCATAGAGGTAATCAAATCAGAGTTGTTCGT
AGTGTAAGAGATTTGACTTGTCCTACTGGTAAGATATACATTTATGATGGCCTTTATAAA
ATAAGAGAAGCATGGGTGGAGAAAGGAAAAACTGGCTTTAATGTGTTTAAACACAAGCTG
CTCAGAGAACCTGGTCAACCTGATGGCATAGCAGTGTGGAAGAAGACTGAAAAATGGAGG
GAGAATCCTTCCTCTCGAGACCATGTTATATTGCGTGACATATCATATGGTGCAGAAAGC
AAGCCTGTTTGCCTTGTGAATGAAGTGGATGATGAGAAAGGTCCTAGCCACTTCAACTAC
ACAACTAAACTGAACTACAGGAATTCTCTCAGCTCAATGAGAAAGATGCAAGGCTGCAAT
TGCGCAAGTGTGTGCCTTCCTGGTGATAACAACTGCTCTTGCACTCATCGAAATGCCGGT
GATCTTCCATACAGTGCTTCAGGCATACTTGTTAGCCGGATGCCTATGCTGTATGAGTGT
AACGATTCCTGTACATGCTCACATAATTGCCGGAACCGAGTTGTACAGAAAGGTTCTCAG
ATCCACTTTGAGGTGTTTAAGACAGGAGATCGAGGTTGGGGACTTCGTAGTTGGGATCCA
ATTCGGGCAGGCACATTTATTTGTGAATATGCAGGAGAAGTTATTGACAGAAACAGTATC
ATTGGAGAAGATGATTACATCTTTGAGACACCGTCTTCTGAGCAGAATTTAAGATGGAAC
TATGCACCAGAATTACTGGGTGAACCCAGTCTTTCTGACTCAAGTGAGACACCTAAGCAA
CTGCCAATAATTATCAGTGCAAAACGAACTGGAAACATAGCTCGCTTTATGAACCACAGC
TGCTCACCAAATGTTTTTTGGCAACCAGTTTTGTATGATCATGGTGACGAGGGATATCCA
CATATCGCATTCTTTGCAATCAAGCATATTCCTCCGATGACAGAGCTTACATATGATTAT
GGTCAGAGCCAGGGTAATGTTCAACTGGGAATCACTATGAAGCAGCAGGGTGCATTCAGT
GTTTCAAGATGCCATGTAATAAGGTTGGCCTTCGTCTGGATGAGAATGCAAAAGAGGGTA
TTTATTGCAGAAAGCATTGGCATTGTACCAAACTTTATTGGAATAACTAGTATTTAG

Protein

539 aa

>Os11t0602200-02 Similar to SET1.
LFSDDPRESVDNVLMMFDALRRRLMQLDEVKQGAKQQHNLKAGSIMMSAELRANKNKRIG
EVPGVEVGDMFYFRIEMCLVGLNSQSMSGIDYMSAKFGNEEDPVAISIVSAGVYENTEDD
PDVLVYTGQGMSGKDDQKLERGNLALERSLHRGNQIRVVRSVRDLTCPTGKIYIYDGLYK
IREAWVEKGKTGFNVFKHKLLREPGQPDGIAVWKKTEKWRENPSSRDHVILRDISYGAES
KPVCLVNEVDDEKGPSHFNYTTKLNYRNSLSSMRKMQGCNCASVCLPGDNNCSCTHRNAG
DLPYSASGILVSRMPMLYECNDSCTCSHNCRNRVVQKGSQIHFEVFKTGDRGWGLRSWDP
IRAGTFICEYAGEVIDRNSIIGEDDYIFETPSSEQNLRWNYAPELLGEPSLSDSSETPKQ
LPIIISAKRTGNIARFMNHSCSPNVFWQPVLYDHGDEGYPHIAFFAIKHIPPMTELTYDY
GQSQGNVQLGITMKQQGAFSVSRCHVIRLAFVWMRMQKRVFIAESIGIVPNFIGITSI*

CDS

chr11:23161432..23162904 (+ strand) : 1473 bp

chr11:23163843..23163986 (+ strand) : 144 bp

3'UTR

chr11:23163987..23164227 (+ strand) : 241 bp

FASTA

>Os11t0602200-02 class=Sequence position=chr11:23161432..23164227 (+ strand)
TTGTTTTCAG ATGATCCTAG GGAATCTGTT GATAATGTAC TCATGATGTT TGATGCACTG CGGCGGAGGC TCATGCAGTT
GGATGAGGTG AAGCAAGGAG CAAAGCAGCA ACATAACTTA AAGGCCGGGA GTATCATGAT GAGTGCTGAA CTTCGTGCAA
ATAAGAACAA GAGGATTGGA GAGGTTCCAG GTGTCGAGGT TGGTGATATG TTCTACTTCA GAATAGAGAT GTGTCTGGTT
GGACTGAATA GTCAGAGCAT GTCTGGGATT GATTACATGT CTGCTAAGTT TGGTAATGAG GAGGATCCTG TGGCTATCAG
TATCGTGTCA GCTGGTGTGT ATGAGAATAC CGAAGATGAC CCAGATGTGC TGGTTTACAC TGGACAGGGC ATGTCTGGAA
AGGATGACCA AAAGCTTGAA AGAGGTAATC TTGCACTTGA AAGGAGTTTG CATAGAGGTA ATCAAATCAG AGTTGTTCGT
AGTGTAAGAG ATTTGACTTG TCCTACTGGT AAGATATACA TTTATGATGG CCTTTATAAA ATAAGAGAAG CATGGGTGGA
GAAAGGAAAA ACTGGCTTTA ATGTGTTTAA ACACAAGCTG CTCAGAGAAC CTGGTCAACC TGATGGCATA GCAGTGTGGA
AGAAGACTGA AAAATGGAGG GAGAATCCTT CCTCTCGAGA CCATGTTATA TTGCGTGACA TATCATATGG TGCAGAAAGC
AAGCCTGTTT GCCTTGTGAA TGAAGTGGAT GATGAGAAAG GTCCTAGCCA CTTCAACTAC ACAACTAAAC TGAACTACAG
GAATTCTCTC AGCTCAATGA GAAAGATGCA AGGCTGCAAT TGCGCAAGTG TGTGCCTTCC TGGTGATAAC AACTGCTCTT
GCACTCATCG AAATGCCGGT GATCTTCCAT ACAGTGCTTC AGGCATACTT GTTAGCCGGA TGCCTATGCT GTATGAGTGT
AACGATTCCT GTACATGCTC ACATAATTGC CGGAACCGAG TTGTACAGAA AGGTTCTCAG ATCCACTTTG AGGTGTTTAA
GACAGGAGAT CGAGGTTGGG GACTTCGTAG TTGGGATCCA ATTCGGGCAG GCACATTTAT TTGTGAATAT GCAGGAGAAG
TTATTGACAG AAACAGTATC ATTGGAGAAG ATGATTACAT CTTTGAGACA CCGTCTTCTG AGCAGAATTT AAGATGGAAC
TATGCACCAG AATTACTGGG TGAACCCAGT CTTTCTGACT CAAGTGAGAC ACCTAAGCAA CTGCCAATAA TTATCAGTGC
AAAACGAACT GGAAACATAG CTCGCTTTAT GAACCACAGC TGCTCACCAA ATGTTTTTTG GCAACCAGTT TTGTATGATC
ATGGTGACGA GGGATATCCA CATATCGCAT TCTTTGCAAT CAAGCATATT CCTCCGATGA CAGAGCTTAC ATATGATTAT
GGTCAGAGCC AGGGTAATGT TCAACTGGGA ATCAATTCTG GATGTCGGAA GTCCAAAAAC TGCTTATGTT GGTCTCGCAA
GTGCAGAGGT TCCTTTGGCT AAAATGCGAA CCCTGCAACA AAAACATTAA AGCATAATCT GCCATTGCAA GGTGAGTCAT
TGGATGTTTT CTCATTTCGT CACCGACAGT ACTATTTTTT CTTGAAAATT GCATGTTCTT ATTTGTGACA ATTATACTTT
CTTTACTATG TTATGGAGTT CATGGCTAGA TACTTGGTAC TTTGGAGGGT GCATAGTGTT CCACCTTTTG AACTGGTTGA
TGGATTGGAA TTTCCAAATA AAAATGGAGT TAAGTAATTT AGTGCCTTCC AGCAAAATGA AGTTGTTATA GCTGGTTCTT
ATTCATTTAA GTGAAGTCAG AACTCACAAC TTCTGTGAGT TGAAGGCTGC TCCTTCACAT TCGCTACGAA ATTTTACTCG
CGAACTGTGA TTTAGCCTGT GTTTCCTGTA CTACTATAGA TTTATATACT GTTATAAGCG GCCAACATGG AAAACTTGGT
AAATGGAAAT TATTTGAAAA ACATATACAC ATTAGTTTTG TGCATACATA TAGTTGAATC ACAAAATATT TGTTCATGAG
TACCACTATC CATTTTGAAC TTTCTAGCGT TGAACACAAA TAATATGACC AGAAGCAACA TAATGTTATG TAAATGTATT
TATACCATGA AGTATCTTCA GTACCTTTCT AAAAGCCTGG CCCTCCTTAC GTCATATTCT TATTACTGAG CATATTTTCT
TTAATTTTTT TAAAGTTTAC ATCACTGTCA ACACAATAAA AGCTAAATAT CTCCTTTTTG GCACATTTTG CCTGTAGATC
CATGTCGATT AACAGATATT GGCAATGTAT TCCATCTCCA TTCTGACAAA TTGAACTGTC CTTACCTACA GAAGTAGGCG
ATTGTTGTAG AACTATGAAG CAGCAGGGTG CATTCAGTGT TTCAAGATGC CATGTAATAA GGTTGGCCTT CGTCTGGATG
AGAATGCAAA AGAGGGTATT TATTGCAGAA AGCATTGGCA TTGTACCAAA CTTTATTGGA ATAACTAGTA TTTAGCGTAG
CATCTGAATT CCGAGAAGGT TGGAACCGTG TTACTATGTT CTTGTAGTGT AGTTGTTTCT CCTGTTTAAG AGAACTTTAC
CAACTGTAGA ATGCCATGCA TATGGTTGCA TCGCAAGATT TTCCTGGGCT TCGCATGCCA GTCGTGCACT CGCCGTATGT
TTTTCTGTAA TATTAATGGC TACATAATGC ATCCTGTAAT AATCATGGTA GTAGCTCCAG TCATCTGCTG AGGTTG

Locus: Os11g0602200

Loading...

Locus: Os11g0602200

Loading...