Os11t0602900-01

Locus

Os11g0602900

Description

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP23

CGSNL Gene Name

CYCLOPHILIN 23

Oryzabase Gene Symbol Synonym(s)

OsCYP23, OsCYP-28, OsCYP23a, OsCYP23b, OsCYP23c

Oryzabase Gene Name Synonym(s)

cyclophilin 23, cyclophilin 28

Transcript Evidence

AK068821 (DDBJ, Best hit)

AK104231 (DDBJ, Best hit)

Protein Evidence

NP_001150697.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Full-length cDNA

J013168A08 (Online Clone Ordering)

006-307-E09 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0602900-01)

Others

Oryzabase (10065)

Transcript

1088 bp

>Os11t0602900-01 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
AGTATACACAATTGCAGCTAAACCAGAGGAGAGAGAGAGAGGAGGTGGGAACTGGGAAGA
AAAAAATGGCGGCTTTGCTCCGCCACGCCGCGGCGGCGGCGGCGGCCGTGGTCCTCCTCA
TCGCGGCGGCCGCCTCCACCGACGGCGCCACCAGCTTCTACGCCTCGGACCCAAACCTCG
GATCCGCCCGCGTCGTCTTCCAGACAACTCATGGTGACATTGAGTTTGGCTTCTTTCCTC
ATGTTGCTCCTAAGACAGTTGAACACATTTACAAACTTGTGAGGCTTGGGTGCTACAACA
CAAATCACTTTTTCCGGGTTGACAAGGGTTTTGTTGCACAAGTTGCTTCTGTTGTGGGTG
GTAGAACTGCCCCCATGAATGATGAGCAGCAAGAGGAAGCAGAGAAATCGGTTGTTGGTG
AATTTAGTACTGTCAAGCATGTCAGGGGGATTCTGTCCATGGGAAGGCACTCTGATCCAA
ACAGTGGTGGTTCTTCCTTTTCCATCCTTCTTGGAGATGCACCACACCTTGATGGACAGT
ATGCTGTATTTGGAAGGCTCACAAAAGGTGATGATACATTAAGAAAACTTGAGCAACTTC
CAACTCGTAGAGAAGGCATATTTGTAATGCCTATTGAGCGTATCAGCATTCTGTCAACAT
ACTATTATGATGTTGATTTAGAGAGCTGTGAAGCAGAAAAGTCCATTCTTAGGAGGAGAC
TTTCTGAATCAGCATCAGAAGTTGAGAGATGGAGAAGAAAGTGCTTTGCATGATGCTGGA
GTTATGTTAGCAGAACAGGTTCAAGCTTCTCCCTGACTTGATTGCTGAGGCCTGAATATT
GAAAGCATGGCGAGGGAACCCCTGGAATGGAATTTGTATGTTGTGTGCATTTATCCTAGC
AAAATGCTGTAACAGTTCAATAGAAGTGTGGATAATTCTCTCTTCTTTTTTTCTGTTAAT
CTTTCCAGCACACTTGGATCTGTACACAACTACACATCATACTGAATTTGTCATTGCTTT
TACAAAAAATACATTGTACTAGTATCTTATTTTACGAAAATATTGTATATTACCATCTCC
ATTTCTGC

CDS

708 bp

>Os11t0602900-01 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
ATGGCGGCTTTGCTCCGCCACGCCGCGGCGGCGGCGGCGGCCGTGGTCCTCCTCATCGCG
GCGGCCGCCTCCACCGACGGCGCCACCAGCTTCTACGCCTCGGACCCAAACCTCGGATCC
GCCCGCGTCGTCTTCCAGACAACTCATGGTGACATTGAGTTTGGCTTCTTTCCTCATGTT
GCTCCTAAGACAGTTGAACACATTTACAAACTTGTGAGGCTTGGGTGCTACAACACAAAT
CACTTTTTCCGGGTTGACAAGGGTTTTGTTGCACAAGTTGCTTCTGTTGTGGGTGGTAGA
ACTGCCCCCATGAATGATGAGCAGCAAGAGGAAGCAGAGAAATCGGTTGTTGGTGAATTT
AGTACTGTCAAGCATGTCAGGGGGATTCTGTCCATGGGAAGGCACTCTGATCCAAACAGT
GGTGGTTCTTCCTTTTCCATCCTTCTTGGAGATGCACCACACCTTGATGGACAGTATGCT
GTATTTGGAAGGCTCACAAAAGGTGATGATACATTAAGAAAACTTGAGCAACTTCCAACT
CGTAGAGAAGGCATATTTGTAATGCCTATTGAGCGTATCAGCATTCTGTCAACATACTAT
TATGATGTTGATTTAGAGAGCTGTGAAGCAGAAAAGTCCATTCTTAGGAGGAGACTTTCT
GAATCAGCATCAGAAGTTGAGAGATGGAGAAGAAAGTGCTTTGCATGA

Protein

236 aa

>Os11t0602900-01 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
MAALLRHAAAAAAAVVLLIAAAASTDGATSFYASDPNLGSARVVFQTTHGDIEFGFFPHV
APKTVEHIYKLVRLGCYNTNHFFRVDKGFVAQVASVVGGRTAPMNDEQQEEAEKSVVGEF
STVKHVRGILSMGRHSDPNSGGSSFSILLGDAPHLDGQYAVFGRLTKGDDTLRKLEQLPT
RREGIFVMPIERISILSTYYYDVDLESCEAEKSILRRRLSESASEVERWRRKCFA*

5'UTR

chr11:23212475..23212539 (+ strand) : 65 bp

CDS

chr11:23212540..23212677 (+ strand) : 138 bp

chr11:23213479..23213592 (+ strand) : 114 bp

chr11:23213678..23213826 (+ strand) : 149 bp

chr11:23214190..23214262 (+ strand) : 73 bp

chr11:23214343..23214432 (+ strand) : 90 bp

chr11:23214787..23214826 (+ strand) : 40 bp

chr11:23215614..23215696 (+ strand) : 83 bp

chr11:23215814..23215834 (+ strand) : 21 bp

3'UTR

chr11:23215835..23215851 (+ strand) : 17 bp

chr11:23217164..23217461 (+ strand) : 298 bp

FASTA

>Os11t0602900-01 class=Sequence position=chr11:23212475..23217461 (+ strand)
AGTATACACA ATTGCAGCTA AACCAGAGGA GAGAGAGAGA GGAGGTGGGA ACTGGGAAGA AAAAAATGGC GGCTTTGCTC
CGCCACGCCG CGGCGGCGGC GGCGGCCGTG GTCCTCCTCA TCGCGGCGGC CGCCTCCACC GACGGCGCCA CCAGCTTCTA
CGCCTCGGAC CCAAACCTCG GATCCGCCCG CGTCGTCTTC CAGGTTCGCC ACGATCTCCC TCATTTTCCC GAGTTGCTGT
TCTAAATCAG GGAGGAAAGG AGCGGTTTTT ACCGGGGTTC ATGGAGAAAA CGGGGCCAAA AGTCGGATTT TGGCACGGTC
AGATTCGTAG GCTCATCAAA GATTTCGGAA TTGTGAGTTG TGAGTGAAGA TCTACGCTGA ATTCCGACGC CGTTGCTCTT
GCTGTTCGCC AGATTCGTCC GACTGTTGGA GAATCGGTTT AGTGCTGTGT TGGAAATTTA AGAGTTGTGT TGCAATTAGA
TGTTGCAAAA CAAGGGGTAC AAGGTGTCAA TCCTCATGCG CAGGCAGTGT TGAACTGTCC GTTCCTATGC TTATTGCGAG
ATTTTACTAG GATTAGGTTA AAATTTAGAT GTATGCCACC TAGTGTGCAA TTGGGAGAAT GCCAGGACGC CGATCAGGCA
ACCAGTCTCA TGTGGCATTC GTTGCTACAA ACTTCTGATT TCCTAAAAAT GAACAAGAAC ACTTACGAGG AAGAGGAAGT
ATGCATCTTT ATTATTTAAG CCGGTGACAG GGCTGAAGCT AATTATCTCG TTAATCAGGA TTTAAAATAA CAGGATATCT
TAATATTTTG GATATGTTCT TCCATTTCAG ATTCTATATC TCGTATTGGT GTTATAATAT CACATCATTT TATTTTTCAA
TTTGTTATGA AATGCCTTGG CTAATGTCCT GGTGCAGCTA ATACACACTA GGCAAAATTG GTTCTATAGC ATCCAAAGTT
GGTAGTATCT GTTCTTATTT CTGATTAGGC AATTTGATCT GCAGACAACT CATGGTGACA TTGAGTTTGG CTTCTTTCCT
CATGTTGCTC CTAAGACAGT TGAACACATT TACAAACTTG TGAGGCTTGG GTGCTACAAC ACAAATCACT TTTTCCGGGT
AATTACCTCT TAGTGCTAAC CTTTCATTTT TGCTAAACGA CTTTGTCAGT TTCATTATGT AAAGGGTCGA TGACTGGGTT
CAGGTTGACA AGGGTTTTGT TGCACAAGTT GCTTCTGTTG TGGGTGGTAG AACTGCCCCC ATGAATGATG AGCAGCAAGA
GGAAGCAGAG AAATCGGTTG TTGGTGAATT TAGTACTGTC AAGCATGTCA GGGGGATTCT GTCCATGGGA AGGTATTTCC
TTTGTCAATT TGTGAATACA TTGTTGATGT TTTAACAGAT CACTTTTGCT ACCTTCTGGT TATAGCCAAA ACAACATGAG
CATGTAGTAC CTTCTGTAAT CCCTCAAAAG TTTATCAATG ATTACCAGGT TGATAAAAGG ATAGGTATTG AAGAAGATCC
TTTATATATT CCATAGTTAA TTTGTCTATT TGTCTAAATC AAAATGAATG CGATAGTTAT TGGGCAAAGT AGTCCTAGAA
AATATCATGA ACTAATTTCC TTGGCGTTTA TCTTGATTTT TTTATGAAAT CACTTATTTT CATATGCCTG CAATGATATA
ACATCACCTA TCACCTTTTC CCCCCCTTCT CCAAGGCACT CTGATCCAAA CAGTGGTGGT TCTTCCTTTT CCATCCTTCT
TGGAGATGCA CCACACCTTG ATGGACAGGT GTTCAACAAT TTCTTCAGTG GTTCATGATT AAATACCAGG TGCTTAAATG
ATTAAACATT GATTCATAAT AATTTCAGTA TGCTGTATTT GGAAGGCTCA CAAAAGGTGA TGATACATTA AGAAAACTTG
AGCAACTTCC AACTCGTAGA GAAGGCATAT TTGTAATGGT ATGTATACGT CCACCTGCAA TGTACAGCAT TTTCTTTTAT
GTAGGCATAA AACATCCTTT AGTTTTTCCT TAAATCACAT AATGATTTCT CTGCTGCAAA TCCTCTGTAA AAGGTTTGTA
GTTAAAATAA TGTATTCAAG TTTTTGGTCA GATAGATATT CCTTTTTTTT TTGCCTCATT AGTGTGTGTT TTGTCCAAGC
AGGCTCACTG AACACGCATG GCTTTAGAAA TACTTGAACC CTTACGCAAT CTTATCACTT CTATTATATT CTTGAACTTC
GTGTCAAAGT GTATTACATA CATGACAAAT GATGAAATGA AACATTAACA TTTTTTTTTT GGTTATTTTC AGCCTATTGA
GCGTATCAGC ATTCTGTCAA CATACTATTA TGGTAAGGAA TTGAAAAGAA TTAAACGTTT CTTGTTTTAT CTCCTATTTA
TCTCTTTTGG TGCTTCTAAA ATCTTATAAT GCAAACCAAA TGCAATTTAG CATTATGTAA CACATAATGT TTGACATACA
GTGTTATGTG TTTCCTTAGA ATGCATGTCC TTGAGATGAG ATCATCTTTA CAACGTTTTA GAATTTATTT TTAATAAAAT
GTATATGTTT TTAGATTTCA AGCTTTTAGT TTGTACCATT CAAATGTTGA ATTTGCTCTA GTAGTGGAAC AGGCAGGTGG
AAATTTGAAT ATTGTTGGCA TTGGGTATGT ATAGAGATTA GATAGGTGTG TACCACGCTG ATAAAGCAAC CCTGTCATGT
GATAAGAAAC TATAATGTTA GCATCTAAAG TTCTGACCTT TACGTAATAA TGAAGTAGTA TTAATTCATG CCATATTCTT
AGTTCAATTA TTCTGATCTC TGCCCAATCA CCAAAATGTC TTACCATATT CGGATTTCTG ATACCGTACT TGCAAGTTGT
CTAGCGCTTT TATCATGCCA TGTTTATTAC GCATGTCCTG ATTAAGGCCT CTGATATATA TATTTTTTGA CCTGTTCTAT
GTTACATTTT CCAATGTTTC TCTATATTTT TATATCAACA CATCCATATG CAGTATATTT TATCCATATA TTTTATAGTG
CATATGTGTA GAGCCGGCAT AAACAGAGTT TTATATGTAG ATGTTTGTAA TTCGGATTTG AAGTGTTCAC ATTTCTGGAC
ATTTTGTTAT CTTATGCAGA TGTTGATTTA GAGAGCTGTG AAGCAGAAAA GTCCATTCTT AGGAGGAGAC TTTCTGAATC
AGCATCAGAA GTTGAGAGAT GGGTGAGAAT CTTATGCTAG AAATGTTAAG GGGAAAACTT CTTACGCTAT GACTTCAATG
CAGATTCCAA AGAAATAGCT CATGTGATCA ACTAAGTTAA CTTATGTTTG TTTTTGCAGA GAAGAAAGTG CTTTGCATGA
TGCTGGAGTT ATGTTAGGTG ATTTTCTTGT TTATGATTTT TATTAGAATA TGATTTACAA AATGGCAACT TGTTAGTTAG
AAACTTAGAA TGAAAATGAT ATCCAAATAA TATTGATTCT TTCTTGCCTT CAGTTTTGTC CTGTTTGTCA GAAGATTATC
AGTTTGCCAA TTTTTAGACA GGAGAGCATA TCTTTCTTTA ATTTTGGTTA ATCAAAAGTG ATCTTGTTCA TGTAAAAGCT
TCGGTAGCGC TTAAACAATT AGCTTGTCTA AATTTCATTT AACCACCATC AACTCGACAT TTAATGTCAT GACAAAACCA
TGTAATAATC TTCCCTAAAT CTTAATGAAA TTTTGTCGGC CAATCTTTCG GCTGTCCGCC AAAAATATAA CATATAAGTG
AACATGTAGT TTCATCTTGT ATCTCTGTAG TATTTCCTTA ATGATTGATC TCACCACTGA GCTTGTGAGC TAGTATCCTC
ATTGATTAAT TACTTCTGCT ACCTTCAACA AAGTTAGTGC CATGCTAATG CTTGTTATAG ACTAATAGGT GTTAGTACAG
TACTGTCTTG TTTTAATGAT AATCCGGGAG TCACCATCGG ATAGCAGGCT GTTGGTTCTC TATTCTCATC AACCCTGTAG
AGATTAATCT CGCTAGAACT ATATAAGTAA TATAACTCAG TCTTTACTGA ATGATAATGG CTTCTCTCAA CTGTTAGATT
CGACGTTGTT AGCAGATAAT GCAAATGAAA GTAGTTATTT CTTGATCTCT TATTTCTTCC ATCAATAAGT CTTCATTCTC
CATCAATATG GAAGGAGAGG AATAACAGGG TCTTCAACCA ACAACAGAAG CCTTGGGTCG AAGTGGCGAA GGTTATGGCT
GCCGAGGCGG AACTATGGCA CTTAGTAAAT GCAGCGGTGC CAGAATTGCC TCTTCCTAGC TTGGTTCCAC GGTCGCAAAA
TCTAGTCGGA GATTAGGCCT TTAGCTCCAT TCTGTGTCCT GTAACCTGTC CCCTTCTTTT TTTCAGTTTT CGGATCCGTT
GTTTATAAAC TTTATTCCTC TTAATACAAA GATGCGCCGC TTGCGTATTC CCAAAAAAAC TCTATCGCGG ACCTTTTAGC
ACAGTACTTC ATTGGCAAGT AGTAAGGGCT ACAAGGATAA AATCATAAAA TTGACTTGAT CTGCTGATCA ATTGGCTACA
AGGATAAAAT CATAAAATTT CAGTCCTTAC AGAAAGAGAA AGAATGCATA GTTAAATTTG TAGTTGAATT TCTTCATTCT
TTGCACATAC TTGCCTGTCC ATGTGTATTC AGTTTTCTCT GTTATGCAGC AGAACAGGTT CAAGCTTCTC CCTGACTTGA
TTGCTGAGGC CTGAATATTG AAAGCATGGC GAGGGAACCC CTGGAATGGA ATTTGTATGT TGTGTGCATT TATCCTAGCA
AAATGCTGTA ACAGTTCAAT AGAAGTGTGG ATAATTCTCT CTTCTTTTTT TCTGTTAATC TTTCCAGCAC ACTTGGATCT
GTACACAACT ACACATCATA CTGAATTTGT CATTGCTTTT ACAAAAAATA CATTGTACTA GTATCTTATT TTACGAAAAT
ATTGTATATT ACCATCTCCA TTTCTGC

Locus: Os11g0602900

Loading...

Locus: Os11g0602900

Loading...