Os11t0602900-02

Locus

Os11g0602900

Description

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP23

CGSNL Gene Name

CYCLOPHILIN 23

Oryzabase Gene Symbol Synonym(s)

OsCYP23, OsCYP-28, OsCYP23a, OsCYP23b, OsCYP23c

Oryzabase Gene Name Synonym(s)

cyclophilin 23, cyclophilin 28

Transcript Evidence

AK059904 (DDBJ, Best hit)

Protein Evidence

NP_001150697.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Full-length cDNA

006-208-G11 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0602900-02)

RiceXPro (AK059904)

Others

Oryzabase (10065)

KEGG (Os11t0602900-02)

Transcript

1058 bp

>Os11t0602900-02 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
AGAGAGAGAGGAGGTGGGAACTGGGAAGAAAAAAATGGCGGCTTTGCTCCGCCACGCCGC
GGCGGCGGCGGCGGCCGTGGTCCTCCTCATCGCGGCGGCCGCCTCCACCGACGGCGCCAC
CAGCTTCTACGCCTCGGACCCAAACCTCGGATCCGCCCGCGTCGTCTTCCAGACAACTCA
TGGTGACATTGAGTTTGGCTTCTTTCCTCATGTTGCTCCTAAGACAGTTGAACACATTTA
CAAACTTGTGAGGCTTGGGTGCTACAACACAAATCACTTTTTCCGGGTTGACAAGGGTTT
TGTTGCACAAGTTGCTTCTGTTGTGGGTGGTAGAACTGCCCCCATGAATGATGAGCAGCA
AGAGGAAGCAGAGAAATCGGTTGTTGGTGAATTTAGTACTGTCAAGCATGTCAGGGGGAT
TCTGTCCATGGGAAGGCACTCTGATCCAAACAGTGGTGGTTCTTCCTTTTCCATCCTTCT
TGGAGATGCACCACACCTTGATGGACAGTATGCTGTATTTGGAAGGCTCACAAAAGGTGA
TGATACATTAAGAAAACTTGAGCAACTTCCAACTCGTAGAGAAGGCATATTTGTAATGCC
TATTGAGCGTATCAGCATTCTGTCAACATACTATTATGATGTTGATTTAGAGAGCTGTGA
AGCAGAAAAGTCCATTCTTAGGAGGAGACTTTCTGAATCAGCATCAGAAGTTGAGAGATG
GAGAAGAAAGTGCTTTGCATGATGCTGGAGTTATGTTAGAACAGGTTCAAGCTTCTCCCT
GACTTGATTGCTGAGGCCTGAATATTGAAAGCATGGCGAGGGAACCCCTGGAATGGAATT
TGTATGTTGTGTGCATTTATCCTAGCAAAATGCTGTAACAGTTCAATAGAAGTGTGGATA
ATTCTCTCTTCTTTTTTTCTGTTAATCTTTCCAGCACACTTGGATCTGTACACAACTACA
CATCATACTGAATTTGTCATTGCTTTTACAAAAAATACATTGTACTAGTATCTTATTTTA
CGAAAATATTGTATATTACCATCTCCATTTCTGCACCT

CDS

708 bp

>Os11t0602900-02 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
ATGGCGGCTTTGCTCCGCCACGCCGCGGCGGCGGCGGCGGCCGTGGTCCTCCTCATCGCG
GCGGCCGCCTCCACCGACGGCGCCACCAGCTTCTACGCCTCGGACCCAAACCTCGGATCC
GCCCGCGTCGTCTTCCAGACAACTCATGGTGACATTGAGTTTGGCTTCTTTCCTCATGTT
GCTCCTAAGACAGTTGAACACATTTACAAACTTGTGAGGCTTGGGTGCTACAACACAAAT
CACTTTTTCCGGGTTGACAAGGGTTTTGTTGCACAAGTTGCTTCTGTTGTGGGTGGTAGA
ACTGCCCCCATGAATGATGAGCAGCAAGAGGAAGCAGAGAAATCGGTTGTTGGTGAATTT
AGTACTGTCAAGCATGTCAGGGGGATTCTGTCCATGGGAAGGCACTCTGATCCAAACAGT
GGTGGTTCTTCCTTTTCCATCCTTCTTGGAGATGCACCACACCTTGATGGACAGTATGCT
GTATTTGGAAGGCTCACAAAAGGTGATGATACATTAAGAAAACTTGAGCAACTTCCAACT
CGTAGAGAAGGCATATTTGTAATGCCTATTGAGCGTATCAGCATTCTGTCAACATACTAT
TATGATGTTGATTTAGAGAGCTGTGAAGCAGAAAAGTCCATTCTTAGGAGGAGACTTTCT
GAATCAGCATCAGAAGTTGAGAGATGGAGAAGAAAGTGCTTTGCATGA

Protein

236 aa

>Os11t0602900-02 Peptidyl-prolyl cis-trans isomerase, cyclophilin-type domain containing protein.
MAALLRHAAAAAAAVVLLIAAAASTDGATSFYASDPNLGSARVVFQTTHGDIEFGFFPHV
APKTVEHIYKLVRLGCYNTNHFFRVDKGFVAQVASVVGGRTAPMNDEQQEEAEKSVVGEF
STVKHVRGILSMGRHSDPNSGGSSFSILLGDAPHLDGQYAVFGRLTKGDDTLRKLEQLPT
RREGIFVMPIERISILSTYYYDVDLESCEAEKSILRRRLSESASEVERWRRKCFA*

5'UTR

chr11:23212506..23212539 (+ strand) : 34 bp

CDS

chr11:23212540..23212677 (+ strand) : 138 bp

chr11:23213479..23213592 (+ strand) : 114 bp

chr11:23213678..23213826 (+ strand) : 149 bp

chr11:23214190..23214262 (+ strand) : 73 bp

chr11:23214343..23214432 (+ strand) : 90 bp

chr11:23214787..23214826 (+ strand) : 40 bp

chr11:23215614..23215696 (+ strand) : 83 bp

chr11:23215814..23215834 (+ strand) : 21 bp

3'UTR

chr11:23215835..23215851 (+ strand) : 17 bp

chr11:23217167..23217465 (+ strand) : 299 bp

FASTA

>Os11t0602900-02 class=Sequence position=chr11:23212506..23217465 (+ strand)
AGAGAGAGAG GAGGTGGGAA CTGGGAAGAA AAAAATGGCG GCTTTGCTCC GCCACGCCGC GGCGGCGGCG GCGGCCGTGG
TCCTCCTCAT CGCGGCGGCC GCCTCCACCG ACGGCGCCAC CAGCTTCTAC GCCTCGGACC CAAACCTCGG ATCCGCCCGC
GTCGTCTTCC AGGTTCGCCA CGATCTCCCT CATTTTCCCG AGTTGCTGTT CTAAATCAGG GAGGAAAGGA GCGGTTTTTA
CCGGGGTTCA TGGAGAAAAC GGGGCCAAAA GTCGGATTTT GGCACGGTCA GATTCGTAGG CTCATCAAAG ATTTCGGAAT
TGTGAGTTGT GAGTGAAGAT CTACGCTGAA TTCCGACGCC GTTGCTCTTG CTGTTCGCCA GATTCGTCCG ACTGTTGGAG
AATCGGTTTA GTGCTGTGTT GGAAATTTAA GAGTTGTGTT GCAATTAGAT GTTGCAAAAC AAGGGGTACA AGGTGTCAAT
CCTCATGCGC AGGCAGTGTT GAACTGTCCG TTCCTATGCT TATTGCGAGA TTTTACTAGG ATTAGGTTAA AATTTAGATG
TATGCCACCT AGTGTGCAAT TGGGAGAATG CCAGGACGCC GATCAGGCAA CCAGTCTCAT GTGGCATTCG TTGCTACAAA
CTTCTGATTT CCTAAAAATG AACAAGAACA CTTACGAGGA AGAGGAAGTA TGCATCTTTA TTATTTAAGC CGGTGACAGG
GCTGAAGCTA ATTATCTCGT TAATCAGGAT TTAAAATAAC AGGATATCTT AATATTTTGG ATATGTTCTT CCATTTCAGA
TTCTATATCT CGTATTGGTG TTATAATATC ACATCATTTT ATTTTTCAAT TTGTTATGAA ATGCCTTGGC TAATGTCCTG
GTGCAGCTAA TACACACTAG GCAAAATTGG TTCTATAGCA TCCAAAGTTG GTAGTATCTG TTCTTATTTC TGATTAGGCA
ATTTGATCTG CAGACAACTC ATGGTGACAT TGAGTTTGGC TTCTTTCCTC ATGTTGCTCC TAAGACAGTT GAACACATTT
ACAAACTTGT GAGGCTTGGG TGCTACAACA CAAATCACTT TTTCCGGGTA ATTACCTCTT AGTGCTAACC TTTCATTTTT
GCTAAACGAC TTTGTCAGTT TCATTATGTA AAGGGTCGAT GACTGGGTTC AGGTTGACAA GGGTTTTGTT GCACAAGTTG
CTTCTGTTGT GGGTGGTAGA ACTGCCCCCA TGAATGATGA GCAGCAAGAG GAAGCAGAGA AATCGGTTGT TGGTGAATTT
AGTACTGTCA AGCATGTCAG GGGGATTCTG TCCATGGGAA GGTATTTCCT TTGTCAATTT GTGAATACAT TGTTGATGTT
TTAACAGATC ACTTTTGCTA CCTTCTGGTT ATAGCCAAAA CAACATGAGC ATGTAGTACC TTCTGTAATC CCTCAAAAGT
TTATCAATGA TTACCAGGTT GATAAAAGGA TAGGTATTGA AGAAGATCCT TTATATATTC CATAGTTAAT TTGTCTATTT
GTCTAAATCA AAATGAATGC GATAGTTATT GGGCAAAGTA GTCCTAGAAA ATATCATGAA CTAATTTCCT TGGCGTTTAT
CTTGATTTTT TTATGAAATC ACTTATTTTC ATATGCCTGC AATGATATAA CATCACCTAT CACCTTTTCC CCCCCTTCTC
CAAGGCACTC TGATCCAAAC AGTGGTGGTT CTTCCTTTTC CATCCTTCTT GGAGATGCAC CACACCTTGA TGGACAGGTG
TTCAACAATT TCTTCAGTGG TTCATGATTA AATACCAGGT GCTTAAATGA TTAAACATTG ATTCATAATA ATTTCAGTAT
GCTGTATTTG GAAGGCTCAC AAAAGGTGAT GATACATTAA GAAAACTTGA GCAACTTCCA ACTCGTAGAG AAGGCATATT
TGTAATGGTA TGTATACGTC CACCTGCAAT GTACAGCATT TTCTTTTATG TAGGCATAAA ACATCCTTTA GTTTTTCCTT
AAATCACATA ATGATTTCTC TGCTGCAAAT CCTCTGTAAA AGGTTTGTAG TTAAAATAAT GTATTCAAGT TTTTGGTCAG
ATAGATATTC CTTTTTTTTT TGCCTCATTA GTGTGTGTTT TGTCCAAGCA GGCTCACTGA ACACGCATGG CTTTAGAAAT
ACTTGAACCC TTACGCAATC TTATCACTTC TATTATATTC TTGAACTTCG TGTCAAAGTG TATTACATAC ATGACAAATG
ATGAAATGAA ACATTAACAT TTTTTTTTTG GTTATTTTCA GCCTATTGAG CGTATCAGCA TTCTGTCAAC ATACTATTAT
GGTAAGGAAT TGAAAAGAAT TAAACGTTTC TTGTTTTATC TCCTATTTAT CTCTTTTGGT GCTTCTAAAA TCTTATAATG
CAAACCAAAT GCAATTTAGC ATTATGTAAC ACATAATGTT TGACATACAG TGTTATGTGT TTCCTTAGAA TGCATGTCCT
TGAGATGAGA TCATCTTTAC AACGTTTTAG AATTTATTTT TAATAAAATG TATATGTTTT TAGATTTCAA GCTTTTAGTT
TGTACCATTC AAATGTTGAA TTTGCTCTAG TAGTGGAACA GGCAGGTGGA AATTTGAATA TTGTTGGCAT TGGGTATGTA
TAGAGATTAG ATAGGTGTGT ACCACGCTGA TAAAGCAACC CTGTCATGTG ATAAGAAACT ATAATGTTAG CATCTAAAGT
TCTGACCTTT ACGTAATAAT GAAGTAGTAT TAATTCATGC CATATTCTTA GTTCAATTAT TCTGATCTCT GCCCAATCAC
CAAAATGTCT TACCATATTC GGATTTCTGA TACCGTACTT GCAAGTTGTC TAGCGCTTTT ATCATGCCAT GTTTATTACG
CATGTCCTGA TTAAGGCCTC TGATATATAT ATTTTTTGAC CTGTTCTATG TTACATTTTC CAATGTTTCT CTATATTTTT
ATATCAACAC ATCCATATGC AGTATATTTT ATCCATATAT TTTATAGTGC ATATGTGTAG AGCCGGCATA AACAGAGTTT
TATATGTAGA TGTTTGTAAT TCGGATTTGA AGTGTTCACA TTTCTGGACA TTTTGTTATC TTATGCAGAT GTTGATTTAG
AGAGCTGTGA AGCAGAAAAG TCCATTCTTA GGAGGAGACT TTCTGAATCA GCATCAGAAG TTGAGAGATG GGTGAGAATC
TTATGCTAGA AATGTTAAGG GGAAAACTTC TTACGCTATG ACTTCAATGC AGATTCCAAA GAAATAGCTC ATGTGATCAA
CTAAGTTAAC TTATGTTTGT TTTTGCAGAG AAGAAAGTGC TTTGCATGAT GCTGGAGTTA TGTTAGGTGA TTTTCTTGTT
TATGATTTTT ATTAGAATAT GATTTACAAA ATGGCAACTT GTTAGTTAGA AACTTAGAAT GAAAATGATA TCCAAATAAT
ATTGATTCTT TCTTGCCTTC AGTTTTGTCC TGTTTGTCAG AAGATTATCA GTTTGCCAAT TTTTAGACAG GAGAGCATAT
CTTTCTTTAA TTTTGGTTAA TCAAAAGTGA TCTTGTTCAT GTAAAAGCTT CGGTAGCGCT TAAACAATTA GCTTGTCTAA
ATTTCATTTA ACCACCATCA ACTCGACATT TAATGTCATG ACAAAACCAT GTAATAATCT TCCCTAAATC TTAATGAAAT
TTTGTCGGCC AATCTTTCGG CTGTCCGCCA AAAATATAAC ATATAAGTGA ACATGTAGTT TCATCTTGTA TCTCTGTAGT
ATTTCCTTAA TGATTGATCT CACCACTGAG CTTGTGAGCT AGTATCCTCA TTGATTAATT ACTTCTGCTA CCTTCAACAA
AGTTAGTGCC ATGCTAATGC TTGTTATAGA CTAATAGGTG TTAGTACAGT ACTGTCTTGT TTTAATGATA ATCCGGGAGT
CACCATCGGA TAGCAGGCTG TTGGTTCTCT ATTCTCATCA ACCCTGTAGA GATTAATCTC GCTAGAACTA TATAAGTAAT
ATAACTCAGT CTTTACTGAA TGATAATGGC TTCTCTCAAC TGTTAGATTC GACGTTGTTA GCAGATAATG CAAATGAAAG
TAGTTATTTC TTGATCTCTT ATTTCTTCCA TCAATAAGTC TTCATTCTCC ATCAATATGG AAGGAGAGGA ATAACAGGGT
CTTCAACCAA CAACAGAAGC CTTGGGTCGA AGTGGCGAAG GTTATGGCTG CCGAGGCGGA ACTATGGCAC TTAGTAAATG
CAGCGGTGCC AGAATTGCCT CTTCCTAGCT TGGTTCCACG GTCGCAAAAT CTAGTCGGAG ATTAGGCCTT TAGCTCCATT
CTGTGTCCTG TAACCTGTCC CCTTCTTTTT TTCAGTTTTC GGATCCGTTG TTTATAAACT TTATTCCTCT TAATACAAAG
ATGCGCCGCT TGCGTATTCC CAAAAAAACT CTATCGCGGA CCTTTTAGCA CAGTACTTCA TTGGCAAGTA GTAAGGGCTA
CAAGGATAAA ATCATAAAAT TGACTTGATC TGCTGATCAA TTGGCTACAA GGATAAAATC ATAAAATTTC AGTCCTTACA
GAAAGAGAAA GAATGCATAG TTAAATTTGT AGTTGAATTT CTTCATTCTT TGCACATACT TGCCTGTCCA TGTGTATTCA
GTTTTCTCTG TTATGCAGCA GAACAGGTTC AAGCTTCTCC CTGACTTGAT TGCTGAGGCC TGAATATTGA AAGCATGGCG
AGGGAACCCC TGGAATGGAA TTTGTATGTT GTGTGCATTT ATCCTAGCAA AATGCTGTAA CAGTTCAATA GAAGTGTGGA
TAATTCTCTC TTCTTTTTTT CTGTTAATCT TTCCAGCACA CTTGGATCTG TACACAACTA CACATCATAC TGAATTTGTC
ATTGCTTTTA CAAAAAATAC ATTGTACTAG TATCTTATTT TACGAAAATA TTGTATATTA CCATCTCCAT TTCTGCACCT

Locus: Os11g0602900

Loading...

Locus: Os11g0602900

Loading...