Os11t0607200-01

Locus

Os11g0607200

Description

Protein kinase, core domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSERL1, OsBAK1-8

Oryzabase Gene Name Synonym(s)

SERK-like gene 1, bri1-associated receptor kinase 1 (BAK1) homologue 8

Transcript Evidence

AK111536 (DDBJ, Best hit)

Protein Evidence

NP_001146903.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine-threonine/tyrosine-protein kinase (IPR001245)

Leucine-rich repeat (IPR001611)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Leucine-rich repeat-containing N-terminal, type 2 (IPR013210)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Protein kinase, ATP binding site (IPR017441)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J013031I11 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0607200-01)

RiceXPro (AK111536)

Others

Oryzabase (13024)

KEGG (Os11t0607200-01)

Transcript

2509 bp

>Os11t0607200-01 Protein kinase, core domain containing protein.
AGGTCGTCTTCTTCCTCCAATCTCTCGTACGAAAGAAGAAAGTTTTTAGGAAGCTAGGAG
CAGCACACAGTCCTTCTCCCTCTCTTCTTGCTATTTAGTGCAGACCTCAAATCCAAAGTG
CTTCTATTTTCCATCAAGAAAGCAAACACAGTGTATTCAAGAGTGCTTCTGTTCCTGAAA
ATTAAACAAATTGATAATAATTTTCAAGGAAGTATGAAACTAATAGCTTTTGGGCTGTTA
TTACTGGGGTATATACAATATTTTGCTACACCTGATTCCGAAGTCATAGCATTGTATGAA
ATAAGGACAATGCTCAATGACAGTCGCGGCGTACTGAATGGCTGGAATAATAATCAAGTT
AGTCCCTGCTATTTTCCTTCCATCAGTTGTAATCAAGATCAAAAGGTCATTTCAATAACT
TTGAGCTCATCAGGATTATCTGGATTCTTGTCACCCAGCATTGGAAAGCTACTATATTTA
CAACAGCTATTATTGAATGATAACAACATAACCGGAGGAATTCCACAAGAGTTAGGGAAC
CTATCAAGCTTAACAACACTAAAACTTGGAGGAAATAGCTTAAATGGTTCAATACCTGAC
TCTCTTGGCCGTCTTTCAAAACTCCAAAATCTGGACATGAGCAAAAATCTCTTAATCGGG
AATATTCCAACTTCTTTGTCTAATCTCTCATCATTGAATGATATCAATCTAGCAGACAAC
AATCTGAGCGGTGAAATACCCAAACGGTTGCTTCAGGTGTCTCACTACAGTTATATAGGT
AACCATTTGAATTGTGGCCAACACTTGATTTCTTGTGAAGGAAACAATATAAATACAGGT
GGATCAAATAACTCCAAACTCAAGGTGGTTGCAAGCATTGGTGGAGCAGTAACTCTCCTT
GTTATCATAGTACTATTTCTGTTATGGTGGCAAAGAATGCGCCACCGACCTGAAATATAC
GTTGATGTTCCAGGTCAACATGATCACAATCTAGAGTTTGGACAGATAAAGCGGTTCTCA
TTGCGAGAACTCCAAATTGCAACCAACAATTTCAGCGAGCAAAATGTTCTTGGCAAGGGT
GGTTTTGGTAAGGTGTACAAAGGAGTGCTTTCAGGTCCACATGGCAGAAAGGTTGCAGTT
AAAAGACTGTTTGAAGTGGAAAAACCTGAAGGGGAAATAGCTTTCCTGAGAGAAGTTGAA
TTGATAAGCATTGCTGTGCACAAGAACATATTAAGATTGATAGGATTCTGCACGACTACA
AAAGAGCGACTCTTGGTCTACCCTTACATGGAGAATCTTAGTGTTGCTTCCCGTTTGAGA
GATATCAAACTAAATGAACCAGCATTAGATTggccaacaagagtgcgaattgcccttggc
gctgcccgtggcttggaataccttcatgagcactgcaaccccaagattatccaccgcgat
gtcaaggcagccaatgtcctgcttgatggaaactttgaagcagtggtaggagactttggg
ttggcgaagatgatagacagagagaggaatacagttacgaccggggttcgcgggacaatg
ggccatatagctcctgagtacctgaagacaggaaggccatcagtgaagacagacatattt
ggatatggtgtaatgttgttagaaatagtgacaggagagcgtgcAGTGTTCCCTGAATTC
TCGGAAGGAGACAGTGAGATCATGCTCAATGATCAAGTGAAAAGGTTGGTGCAAGGAGGA
CGATTGACAGACATTGTGGACCACAACCTGGACACTGCATACGATTTGCAACAGCTGGAG
AAGATGATCCAAATAGCACTCCTCTGCACTCATGTGGAGCCTCATCTTCGCCCTGCTATG
TCAGAGGTTGTGCAGATGCTGGAAGGCAATGTTGTCCCAGCGGAGCAATGGGAGGAGTGG
CAGGTGGCTGAACTTGCCCGGCGGCATCAGCATGAGATGAACCAACAGCGCAGGCTGTTC
AGCTTCAGTGAGGAGTCTCTCAATATCCAGGAAGCCATTCAGCTATCCAGTGGCAGATAA
CTGGAAGATCATACAATTGTATCACATGAGCTTCACTTGTTTCCCAAGAAAGGGTGAAGG
AGCGAGGAGTCTCTCAATATCCAGGAAGACATTCAGCTATCCGGTGGCAGATAACTGGAA
GATCATACAATTGTATCACATGAGCTTCACTTGTTTCCCAAGAAAGGGTGAAAGGAGACA
ACAGTACTCACTATAGTTGTGGATTGTTAGGAATAGCCTAGAGTCCTCACGGTTTGCATA
AGTAACTGTATCTAACCTTTATGCTGTGAACACAATGTCGTGCAGCTACATCTCGTTCAG
ACATTCATGTGTATACATAGACATAGACTACAGACTACTATAGATTATATTCTATAGTGT
TTTTGTGTTAATGTATACTTGGTAAAATGGTAACCCTGTGAATAGATCTTGTACATGAAA
TTTTCTAACGTATAACATAATTCTTAAAAAAGACTCACAAAATTAAGCC

CDS

1827 bp

>Os11t0607200-01 Protein kinase, core domain containing protein.
ATGAAACTAATAGCTTTTGGGCTGTTATTACTGGGGTATATACAATATTTTGCTACACCT
GATTCCGAAGTCATAGCATTGTATGAAATAAGGACAATGCTCAATGACAGTCGCGGCGTA
CTGAATGGCTGGAATAATAATCAAGTTAGTCCCTGCTATTTTCCTTCCATCAGTTGTAAT
CAAGATCAAAAGGTCATTTCAATAACTTTGAGCTCATCAGGATTATCTGGATTCTTGTCA
CCCAGCATTGGAAAGCTACTATATTTACAACAGCTATTATTGAATGATAACAACATAACC
GGAGGAATTCCACAAGAGTTAGGGAACCTATCAAGCTTAACAACACTAAAACTTGGAGGA
AATAGCTTAAATGGTTCAATACCTGACTCTCTTGGCCGTCTTTCAAAACTCCAAAATCTG
GACATGAGCAAAAATCTCTTAATCGGGAATATTCCAACTTCTTTGTCTAATCTCTCATCA
TTGAATGATATCAATCTAGCAGACAACAATCTGAGCGGTGAAATACCCAAACGGTTGCTT
CAGGTGTCTCACTACAGTTATATAGGTAACCATTTGAATTGTGGCCAACACTTGATTTCT
TGTGAAGGAAACAATATAAATACAGGTGGATCAAATAACTCCAAACTCAAGGTGGTTGCA
AGCATTGGTGGAGCAGTAACTCTCCTTGTTATCATAGTACTATTTCTGTTATGGTGGCAA
AGAATGCGCCACCGACCTGAAATATACGTTGATGTTCCAGGTCAACATGATCACAATCTA
GAGTTTGGACAGATAAAGCGGTTCTCATTGCGAGAACTCCAAATTGCAACCAACAATTTC
AGCGAGCAAAATGTTCTTGGCAAGGGTGGTTTTGGTAAGGTGTACAAAGGAGTGCTTTCA
GGTCCACATGGCAGAAAGGTTGCAGTTAAAAGACTGTTTGAAGTGGAAAAACCTGAAGGG
GAAATAGCTTTCCTGAGAGAAGTTGAATTGATAAGCATTGCTGTGCACAAGAACATATTA
AGATTGATAGGATTCTGCACGACTACAAAAGAGCGACTCTTGGTCTACCCTTACATGGAG
AATCTTAGTGTTGCTTCCCGTTTGAGAGATATCAAACTAAATGAACCAGCATTAGATTgg
ccaacaagagtgcgaattgcccttggcgctgcccgtggcttggaataccttcatgagcac
tgcaaccccaagattatccaccgcgatgtcaaggcagccaatgtcctgcttgatggaaac
tttgaagcagtggtaggagactttgggttggcgaagatgatagacagagagaggaataca
gttacgaccggggttcgcgggacaatgggccatatagctcctgagtacctgaagacagga
aggccatcagtgaagacagacatatttggatatggtgtaatgttgttagaaatagtgaca
ggagagcgtgcAGTGTTCCCTGAATTCTCGGAAGGAGACAGTGAGATCATGCTCAATGAT
CAAGTGAAAAGGTTGGTGCAAGGAGGACGATTGACAGACATTGTGGACCACAACCTGGAC
ACTGCATACGATTTGCAACAGCTGGAGAAGATGATCCAAATAGCACTCCTCTGCACTCAT
GTGGAGCCTCATCTTCGCCCTGCTATGTCAGAGGTTGTGCAGATGCTGGAAGGCAATGTT
GTCCCAGCGGAGCAATGGGAGGAGTGGCAGGTGGCTGAACTTGCCCGGCGGCATCAGCAT
GAGATGAACCAACAGCGCAGGCTGTTCAGCTTCAGTGAGGAGTCTCTCAATATCCAGGAA
GCCATTCAGCTATCCAGTGGCAGATAA

Protein

609 aa

>Os11t0607200-01 Protein kinase, core domain containing protein.
MKLIAFGLLLLGYIQYFATPDSEVIALYEIRTMLNDSRGVLNGWNNNQVSPCYFPSISCN
QDQKVISITLSSSGLSGFLSPSIGKLLYLQQLLLNDNNITGGIPQELGNLSSLTTLKLGG
NSLNGSIPDSLGRLSKLQNLDMSKNLLIGNIPTSLSNLSSLNDINLADNNLSGEIPKRLL
QVSHYSYIGNHLNCGQHLISCEGNNINTGGSNNSKLKVVASIGGAVTLLVIIVLFLLWWQ
RMRHRPEIYVDVPGQHDHNLEFGQIKRFSLRELQIATNNFSEQNVLGKGGFGKVYKGVLS
GPHGRKVAVKRLFEVEKPEGEIAFLREVELISIAVHKNILRLIGFCTTTKERLLVYPYME
NLSVASRLRDIKLNEPALDWPTRVRIALGAARGLEYLHEHCNPKIIHRDVKAANVLLDGN
FEAVVGDFGLAKMIDRERNTVTTGVRGTMGHIAPEYLKTGRPSVKTDIFGYGVMLLEIVT
GERAVFPEFSEGDSEIMLNDQVKRLVQGGRLTDIVDHNLDTAYDLQQLEKMIQIALLCTH
VEPHLRPAMSEVVQMLEGNVVPAEQWEEWQVAELARRHQHEMNQQRRLFSFSEESLNIQE
AIQLSSGR*

5'UTR

chr11:23436634..23436723 (- strand) : 90 bp

chr11:23435554..23435676 (- strand) : 123 bp

CDS

chr11:23435484..23435553 (- strand) : 70 bp

chr11:23434830..23434962 (- strand) : 133 bp

chr11:23434428..23434499 (- strand) : 72 bp

chr11:23434179..23434322 (- strand) : 144 bp

chr11:23434006..23434077 (- strand) : 72 bp

chr11:23433840..23433905 (- strand) : 66 bp

chr11:23433700..23433767 (- strand) : 68 bp

chr11:23433485..23433619 (- strand) : 135 bp

chr11:23432997..23433344 (- strand) : 348 bp

chr11:23432318..23432712 (- strand) : 395 bp

chr11:23431702..23432025 (- strand) : 324 bp

3'UTR

chr11:23431233..23431701 (- strand) : 469 bp

FASTA

>Os11t0607200-01 class=Sequence position=chr11:23431233..23436723 (- strand)
AGGTCGTCTT CTTCCTCCAA TCTCTCGTAC GAAAGAAGAA AGTTTTTAGG AAGCTAGGAG CAGCACACAG TCCTTCTCCC
TCTCTTCTTG GTAAGTTCTT GCCACTCTCT AATATATGTG GTAGTACAGC AACAGCAAGC ATGGTTGACT TCTGAATCTG
TTCTCTTCTA CCCTCTTCTC TGCCTGTTTG CTTCAATCAC CTGCCTGTGT CATCTGGTGA ATTTATTCTA TTTCTTCTCA
ATTTAATGGT TCTTTGAGTT GGGGAGGTTT ATGTTGGGAC TTGGGGAGAA GAGGCATCAC CATTGGAGGG ATGGATGAAG
CTTTGCTGTT AGCTCAAACA CCCTGCAGAA CAGCAGAGGT TTCTGTCTGC AATCTCCAGA GCTAAAATTT CTCGGAAATC
AAGAGAGAAT TCAGAGAAGA GTTTACTTTG CGCGTCTTGA GGTTCTTTGC AAGTAGTATT CAGAACAGGG TGTGAACTTT
GAGAAGCTGC TACGTAACTG CAAAGAGAAG AGGACAGCTT GTCTGTCTCT GTTTTTCCTT TTGCTCAGTT TATTCCCCTA
AATCATTTTG GGCTTTTTTT TTGAGCTTCT AACTTCTCCA GTAATGGTTT AGAATTTACA TTTATTTCTT TAAGACAACC
TTTATTTCAA TAGTAACATA CTTTTCATAT TTAAGGACAA CCTTTTAGAC AGTTTAAGGT CTTTTGGACC ACCCCATATT
TGTACAGGCA ATCGATTACA GTGTAACTAT AGAAATCCGG TTAGGTTTAG TGACCGCTGC AAGACTCATA CAGTCAGGTG
ACTGATCACA TGTTTTTTAT ATGCAAGAAA TCAAAAATGG TTTGCAACAA AAATAAAATC TTTATCTCTA GAAAGAATCC
CAAACAGTCT GAATGTTCTT TTAAGGAGAT TCTTGCCTTG TTTGGGTTAA AGCACTTCCT TTCAATTTTG GCAGGAATTT
ATGAAGATTC CTCAATATCT GTATTCTCAG TTTACTCTTT AAGCCTTGTG AGTCTCACAC AATTTATTTT ATTCTTCGGT
GATGCAGCTA TTTAGTGCAG ACCTCAAATC CAAAGTGCTT CTATTTTCCA TCAAGAAAGC AAACACAGTG TATTCAAGAG
TGCTTCTGTT CCTGAAAATT AAACAAATTG ATAATAATTT TCAAGGAAGT ATGAAACTAA TAGCTTTTGG GCTGTTATTA
CTGGGGTATA TACAATATTT TGCTACACCT GATTCCGAAG GTAAGGCCTT TACACTTTGA TGTATATATT TTCTACATCA
GTTATTCATA TGTGGCTGGC ATTAGAAGAG GCAATGGAAT CAATCTGAGA ATTTTGACTG TGAACTGCAA GAGACTCTGG
AATTATTGCA TTATTGAGTT TTTGACTAAC ACAATATTTA CTGAGAACGC TAGGGTGTGT TATGGATATG ACATCTTGTC
CTTGTCATCA GTCAAATGTT TGACTATCAA CTGCATAACA GATTCTAGAG CACTTGTACT TACTACTAGC CTACTAGAAA
GCACAACTAC TACTCCAGTT ATTTAGCACA TCTGCATTTT TCTCCAGTGT AGCAAATATG CTTGCTCACA ATTGTTCATA
ATTGAACAAG ATTGCTCAAA ATTCTTGGTT AGATAATGTA CTCGCTCTAA ATCCATATTG CATATGGGGC ATTGAATAAG
AAGAATATTA CCATTTCCAA TTCTTTTTCA CTGAATGTGT CTCATAATTT GCAAATATGA CGATTTTATT TTCCTCATCA
GTCATAGCAT TGTATGAAAT AAGGACAATG CTCAATGACA GTCGCGGCGT ACTGAATGGC TGGAATAATA ATCAAGTTAG
TCCCTGCTAT TTTCCTTCCA TCAGTTGTAA TCAAGATCAA AAGGTCATTT CAATGTGAGT TATCCCTTCC ATTTTTCTTA
AATATCTTAA ACTCTAAACT TCATTATTTT CCTCTTAACA AGGTTGAATA TCTGAAACTC TTAACTCCAT TATTTTCCTG
CTATGCTAGT TAAATGCATG CTCTAGCCTC TAACCATTGA TCATAAGGAA AAGTTTTTAC AGTTGGCTTG CACATACTTC
ATACTATAGT GTTTCATATT TGTAGTATAT AAGTTTGTTT CACAATAAAA ATAACATTAA AACTTTGTAA CCACATATGG
TTAATTTCTT TTTGAGCCTT TTGAGGTAAA CACATGGTTA ATTTCACATT TCTGGAATTT GCAGAACTTT GAGCTCATCA
GGATTATCTG GATTCTTGTC ACCCAGCATT GGAAAGCTAC TATATTTACA ACAGCTGTAA GCTTAGCAAT TTAATCCTAA
AAATATTTAA CATTTGAAGA TTAATCCTCA TTCCTCAATA AAAGATCTAC TTTGTGGTTC GTTTTATTTT TTTGTTCCTA
GATTATTGAA TGATAACAAC ATAACCGGAG GAATTCCACA AGAGTTAGGG AACCTATCAA GCTTAACAAC ACTAAAACTT
GGAGGAAATA GCTTAAATGG TTCAATACCT GACTCTCTTG GCCGTCTTTC AAAACTCCAA AATCTGTAAG TCAAACTCTG
TGTCTTTCTA AGAATACAAG TAAGATTATG AGTCAATAGT GTAGTAGTTG ATCATAATAA CCGTAATAAT GGGACATCTT
CGACAGGGAC ATGAGCAAAA ATCTCTTAAT CGGGAATATT CCAACTTCTT TGTCTAATCT CTCATCATTG AATGATATGT
AAGTCTTTCT GTGTTGATAA CATTGTGACC TTGCCAAATA TCACCGCTTG GATTACAGTT ACATTATATG ATGTATCACA
TCTCACTGTG ATTTGCAGCA ATCTAGCAGA CAACAATCTG AGCGGTGAAA TACCCAAACG GTTGCTTCAG GTGTCTCACT
ACAGGTATGG GCAAGGATAT ATTCTACAAA CAATTTTACG CCTAGTGCTT CACAATACTG ACAATTGTAA TTCCAGTTAT
ATAGGTAACC ATTTGAATTG TGGCCAACAC TTGATTTCTT GTGAAGGAAA CAATATAAAT ACAGGTAATA TAGAAATCAA
CATGGCAATC TATATTGCCC CCTTAATTTG GATCAATAAA CAATTCCATT CTTTTTATCA ACAGGTGGAT CAAATAACTC
CAAACTCAAG GTGGTTGCAA GCATTGGTGG AGCAGTAACT CTCCTTGTTA TCATAGTACT ATTTCTGTTA TGGTGGCAAA
GAATGCGCCA CCGACCTGAA ATATACGTTG ATGTTCCAGG TTAGTTCAGC AGCATGACAT TTGTGTGATG GTTACTGTAG
GAAACATATT CAGCTAAAGA AACAATTTCA CATGGACTGA AACAGATTAA TAAAGACTCC TTTTTTTACC AAGATGATAA
GCATGTGCAA CAATTTCAGG TCAACATGAT CACAATCTAG AGTTTGGACA GATAAAGCGG TTCTCATTGC GAGAACTCCA
AATTGCAACC AACAATTTCA GCGAGCAAAA TGTTCTTGGC AAGGGTGGTT TTGGTAAGGT GTACAAAGGA GTGCTTTCAG
GTCCACATGG CAGAAAGGTT GCAGTTAAAA GACTGTTTGA AGTGGAAAAA CCTGAAGGGG AAATAGCTTT CCTGAGAGAA
GTTGAATTGA TAAGCATTGC TGTGCACAAG AACATATTAA GATTGATAGG ATTCTGCACG ACTACAAAAG AGCGACTCTT
GGTCTACCCT TACATGGAGA ATCTTAGTGT TGCTTCCCGT TTGAGAGGTA ACAGTAACAT AAGAATATCA CTTTAGCATG
TTCCTAGAAT ATGCATTCAT GATTCATCTT CATTTACAAT GTCAATTGAG GTATATTAGT TAAAACAGTG CCAGGAAATA
GAAGGAAATG TGGTTTCTAT GTCTTGATAA AAAGGAAGTA TAGGCAATTG AATCGTTGAA TTATCTACTT CTTTAGGCAG
GTTACTACCA AAAAAATAGG TCCTTTTATG ATGATACAAA CCCTAAAAAT ATCTAATGCA ATAGTACTGT TGATGACACC
TATGCATGCA GATATCAAAC TAAATGAACC AGCATTAGAT Tggccaacaa gagtgcgaat tgcccttggc gctgcccgtg
gcttggaata ccttcatgag cactgcaacc ccaagattat ccaccgcgat gtcaaggcag ccaatgtcct gcttgatgga
aactttgaag cagtggtagg agactttggg ttggcgaaga tgatagacag agagaggaat acagttacga ccggggttcg
cgggacaatg ggccatatag ctcctgagta cctgaagaca ggaaggccat cagtgaagac agacatattt ggatatggtg
taatgttgtt agaaatagtg acaggagagc gtgcAGTGTT CCCTGAATTC TCGGAAGGAG ACAGTGAGAT CATGCTCAAT
GATCAAGTAA GATATAATTA CATTACCTTA CTATCGTTTA TAGCTACCAA AGAAAGTTTA GATTGCACAC CATTAATAAT
ATCTTATTAA ACTAGAGAAT GGAAGCATAT TAAGATCAGA TAAGCAAAAG CTTCTCACCT ATGTAATTGA TATGAGTAGA
AGTTAGGTAT AACTATGAAT GATGCTTGAC TTATTGTATG AACAATGCAA CATAAATTTT CTGAAGAATT AGAAAGTTGG
TGTCTCATCT TTTCACATAG ATGACCCTGA TGGGATTGAC TCTTTGGTAC ATGTGAAGGT GAAAAGGTTG GTGCAAGGAG
GACGATTGAC AGACATTGTG GACCACAACC TGGACACTGC ATACGATTTG CAACAGCTGG AGAAGATGAT CCAAATAGCA
CTCCTCTGCA CTCATGTGGA GCCTCATCTT CGCCCTGCTA TGTCAGAGGT TGTGCAGATG CTGGAAGGCA ATGTTGTCCC
AGCGGAGCAA TGGGAGGAGT GGCAGGTGGC TGAACTTGCC CGGCGGCATC AGCATGAGAT GAACCAACAG CGCAGGCTGT
TCAGCTTCAG TGAGGAGTCT CTCAATATCC AGGAAGCCAT TCAGCTATCC AGTGGCAGAT AACTGGAAGA TCATACAATT
GTATCACATG AGCTTCACTT GTTTCCCAAG AAAGGGTGAA GGAGCGAGGA GTCTCTCAAT ATCCAGGAAG ACATTCAGCT
ATCCGGTGGC AGATAACTGG AAGATCATAC AATTGTATCA CATGAGCTTC ACTTGTTTCC CAAGAAAGGG TGAAAGGAGA
CAACAGTACT CACTATAGTT GTGGATTGTT AGGAATAGCC TAGAGTCCTC ACGGTTTGCA TAAGTAACTG TATCTAACCT
TTATGCTGTG AACACAATGT CGTGCAGCTA CATCTCGTTC AGACATTCAT GTGTATACAT AGACATAGAC TACAGACTAC
TATAGATTAT ATTCTATAGT GTTTTTGTGT TAATGTATAC TTGGTAAAAT GGTAACCCTG TGAATAGATC TTGTACATGA
AATTTTCTAA CGTATAACAT AATTCTTAAA AAAGACTCAC AAAATTAAGC C

Locus: Os11g0607200

Loading...

Locus: Os11g0607200

Loading...