Os11t0607200-02

Locus

Os11g0607200

Description

Similar to Brassinosteroid insensitive1-associated receptor kinase 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSERL1, OsBAK1-8

Oryzabase Gene Name Synonym(s)

SERK-like gene 1, bri1-associated receptor kinase 1 (BAK1) homologue 8

Transcript Evidence

AK111998 (DDBJ, Best hit)

Protein Evidence

NP_001146903.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine-threonine/tyrosine-protein kinase (IPR001245)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Protein kinase, ATP binding site (IPR017441)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

001-034-E01 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0607200-02)

RiceXPro (AK111998)

Others

Oryzabase (13024)

KEGG (Os11t0607200-02)

Transcript

1755 bp

>Os11t0607200-02 Similar to Brassinosteroid insensitive1-associated receptor kinase 1.
ATCGGGAATATTCCAACTTCTTTGTCTAATCTCTCATCATTGAATGATATCAATCTAGCA
GACAACAATCTGAGCGGTGAAATACCCAAACGGTTGCTTCAGGTGTCTCACTACAGTTAT
ATAGGTAACCATTTGAATTGTGGCCAACACTTGATTTCTTGTGAAGGAAACAATATAAAT
ACAGGTGGATCAAATAACTCCAAACTCAAGGTGGTTGCAAGCATTGGTGGAGCAGTAACT
CTCCTTGTTATCATAGTACTATTTCTGTTATGGTGGCAAAGAATGCGCCACCGACCTGAA
ATATACGTTGATGTTCCAGGTCAACATGATCACAATCTAGAGTTTGGACAGATAAAGCGG
TTCTCATTGCGAGAACTCCAAATTGCAACCAACAATTTCAGCGAGCAAAATGTTCTTGGC
AAGGGTGGTTTTGGTAAGGTGTACAAAGGAGTGCTTTCAGGTCCACATGGCAGAAAGGTT
GCAGTTAAAAGACTGTTTGAAGTGGAAAAACCTGAAGGGGAAATAGCTTTCCTGAGAGAA
GTTGAATTGATAAGCATTGCTGTGCACAAGAACATATTAAGATTGATAGGATTCTGCACG
ACTACAAAAGAGCGACTCTTGGTCTACCCTTACATGGAGAATCTTAGTGTTGCTTCCCGT
TTGAGAGATATCAAACTAAATGAACCAGCATTAGATTggccaacaagagtgcgaattgcc
cttggcgctgcccgtggcttggaataccttcatgagcactgcaaccccaagattatccac
cgcgatgtcaaggcagccaatgtcctgcttgatggaaactttgaagcagtggtaggagac
tttgggttggcgaagatgatagacagagagaggaatacagttacgaccggggttcgcggg
acaatgggccatatagctcctgagtacctgaagacaggaaggccatcagtgaagacagac
atatttggatatggtgtaatgttgttagaaatagtgacaggagagcgtgcAGTGTTCCCT
GAATTCTCGGAAGGAGACAGTGAGATCATGCTCAATGATCAAGTGAAAAGGTTGGTGCAA
GGAGGACGATTGACAGACATTGTGGACCACAACCTGGACACTGCATACGATTTGCAACAG
CTGGAGAAGATGATCCAAATAGCACTCCTCTGCACTCATGTGGAGCCTCATCTTCGCCCT
GCTATGTCAGAGGTTGTGCAGATGCTGGAAGGCAATGTTGTCCCAGCGGAGCAATGGGAG
GAGTGGCAGGTGGCTGAACTTGCCCGGCGGCATCAGCATGAGATGAACCAACAGCGCAGG
CTGTTCAGCTTCAGTGAGGAGTCTCTCAATATCCAGGAAGCCATTCAGCTATCCAGTGGC
AGATAACTGGAAGATCATACAATTGTATCACATGAGCTTCACTTGTTTCCCAAGAAAGGG
TGAAGGAGCGAGGAGTCTCTCAATATCCAGGAAGACATTCAGCTATCCGGTGGCAGATAA
CTGGAAGATCATACAATTGTATCACATGAGCTTCACTTGTTTCCCAAGAAAGGGTGAAAG
GAGACAACAGTACTCACTATAGTTGTGGATTGTTAGGAATAGCCTAGAGTCCTCACGGTT
TGCATAAGTAACTGTATCTAACCTTTATGCTGTGAACACAATGTCGTGCAGCTACATCTC
GTTCAGACATTCATGTGTATACATAGACATAGACTACAGACTACTATAGATTATATTCTA
TAGTGTTTTTGTGTT

CDS

1386 bp

>Os11t0607200-02 Similar to Brassinosteroid insensitive1-associated receptor kinase 1.
ATCGGGAATATTCCAACTTCTTTGTCTAATCTCTCATCATTGAATGATATCAATCTAGCA
GACAACAATCTGAGCGGTGAAATACCCAAACGGTTGCTTCAGGTGTCTCACTACAGTTAT
ATAGGTAACCATTTGAATTGTGGCCAACACTTGATTTCTTGTGAAGGAAACAATATAAAT
ACAGGTGGATCAAATAACTCCAAACTCAAGGTGGTTGCAAGCATTGGTGGAGCAGTAACT
CTCCTTGTTATCATAGTACTATTTCTGTTATGGTGGCAAAGAATGCGCCACCGACCTGAA
ATATACGTTGATGTTCCAGGTCAACATGATCACAATCTAGAGTTTGGACAGATAAAGCGG
TTCTCATTGCGAGAACTCCAAATTGCAACCAACAATTTCAGCGAGCAAAATGTTCTTGGC
AAGGGTGGTTTTGGTAAGGTGTACAAAGGAGTGCTTTCAGGTCCACATGGCAGAAAGGTT
GCAGTTAAAAGACTGTTTGAAGTGGAAAAACCTGAAGGGGAAATAGCTTTCCTGAGAGAA
GTTGAATTGATAAGCATTGCTGTGCACAAGAACATATTAAGATTGATAGGATTCTGCACG
ACTACAAAAGAGCGACTCTTGGTCTACCCTTACATGGAGAATCTTAGTGTTGCTTCCCGT
TTGAGAGATATCAAACTAAATGAACCAGCATTAGATTggccaacaagagtgcgaattgcc
cttggcgctgcccgtggcttggaataccttcatgagcactgcaaccccaagattatccac
cgcgatgtcaaggcagccaatgtcctgcttgatggaaactttgaagcagtggtaggagac
tttgggttggcgaagatgatagacagagagaggaatacagttacgaccggggttcgcggg
acaatgggccatatagctcctgagtacctgaagacaggaaggccatcagtgaagacagac
atatttggatatggtgtaatgttgttagaaatagtgacaggagagcgtgcAGTGTTCCCT
GAATTCTCGGAAGGAGACAGTGAGATCATGCTCAATGATCAAGTGAAAAGGTTGGTGCAA
GGAGGACGATTGACAGACATTGTGGACCACAACCTGGACACTGCATACGATTTGCAACAG
CTGGAGAAGATGATCCAAATAGCACTCCTCTGCACTCATGTGGAGCCTCATCTTCGCCCT
GCTATGTCAGAGGTTGTGCAGATGCTGGAAGGCAATGTTGTCCCAGCGGAGCAATGGGAG
GAGTGGCAGGTGGCTGAACTTGCCCGGCGGCATCAGCATGAGATGAACCAACAGCGCAGG
CTGTTCAGCTTCAGTGAGGAGTCTCTCAATATCCAGGAAGCCATTCAGCTATCCAGTGGC
AGATAA

Protein

462 aa

>Os11t0607200-02 Similar to Brassinosteroid insensitive1-associated receptor kinase 1.
IGNIPTSLSNLSSLNDINLADNNLSGEIPKRLLQVSHYSYIGNHLNCGQHLISCEGNNIN
TGGSNNSKLKVVASIGGAVTLLVIIVLFLLWWQRMRHRPEIYVDVPGQHDHNLEFGQIKR
FSLRELQIATNNFSEQNVLGKGGFGKVYKGVLSGPHGRKVAVKRLFEVEKPEGEIAFLRE
VELISIAVHKNILRLIGFCTTTKERLLVYPYMENLSVASRLRDIKLNEPALDWPTRVRIA
LGAARGLEYLHEHCNPKIIHRDVKAANVLLDGNFEAVVGDFGLAKMIDRERNTVTTGVRG
TMGHIAPEYLKTGRPSVKTDIFGYGVMLLEIVTGERAVFPEFSEGDSEIMLNDQVKRLVQ
GGRLTDIVDHNLDTAYDLQQLEKMIQIALLCTHVEPHLRPAMSEVVQMLEGNVVPAEQWE
EWQVAELARRHQHEMNQQRRLFSFSEESLNIQEAIQLSSGR*

CDS

chr11:23434006..23434055 (- strand) : 50 bp

chr11:23433840..23433905 (- strand) : 66 bp

chr11:23433700..23433767 (- strand) : 68 bp

chr11:23433485..23433619 (- strand) : 135 bp

chr11:23432997..23433344 (- strand) : 348 bp

chr11:23432318..23432712 (- strand) : 395 bp

chr11:23431702..23432025 (- strand) : 324 bp

3'UTR

chr11:23431333..23431701 (- strand) : 369 bp

FASTA

>Os11t0607200-02 class=Sequence position=chr11:23431333..23434055 (- strand)
ATCGGGAATA TTCCAACTTC TTTGTCTAAT CTCTCATCAT TGAATGATAT GTAAGTCTTT CTGTGTTGAT AACATTGTGA
CCTTGCCAAA TATCACCGCT TGGATTACAG TTACATTATA TGATGTATCA CATCTCACTG TGATTTGCAG CAATCTAGCA
GACAACAATC TGAGCGGTGA AATACCCAAA CGGTTGCTTC AGGTGTCTCA CTACAGGTAT GGGCAAGGAT ATATTCTACA
AACAATTTTA CGCCTAGTGC TTCACAATAC TGACAATTGT AATTCCAGTT ATATAGGTAA CCATTTGAAT TGTGGCCAAC
ACTTGATTTC TTGTGAAGGA AACAATATAA ATACAGGTAA TATAGAAATC AACATGGCAA TCTATATTGC CCCCTTAATT
TGGATCAATA AACAATTCCA TTCTTTTTAT CAACAGGTGG ATCAAATAAC TCCAAACTCA AGGTGGTTGC AAGCATTGGT
GGAGCAGTAA CTCTCCTTGT TATCATAGTA CTATTTCTGT TATGGTGGCA AAGAATGCGC CACCGACCTG AAATATACGT
TGATGTTCCA GGTTAGTTCA GCAGCATGAC ATTTGTGTGA TGGTTACTGT AGGAAACATA TTCAGCTAAA GAAACAATTT
CACATGGACT GAAACAGATT AATAAAGACT CCTTTTTTTA CCAAGATGAT AAGCATGTGC AACAATTTCA GGTCAACATG
ATCACAATCT AGAGTTTGGA CAGATAAAGC GGTTCTCATT GCGAGAACTC CAAATTGCAA CCAACAATTT CAGCGAGCAA
AATGTTCTTG GCAAGGGTGG TTTTGGTAAG GTGTACAAAG GAGTGCTTTC AGGTCCACAT GGCAGAAAGG TTGCAGTTAA
AAGACTGTTT GAAGTGGAAA AACCTGAAGG GGAAATAGCT TTCCTGAGAG AAGTTGAATT GATAAGCATT GCTGTGCACA
AGAACATATT AAGATTGATA GGATTCTGCA CGACTACAAA AGAGCGACTC TTGGTCTACC CTTACATGGA GAATCTTAGT
GTTGCTTCCC GTTTGAGAGG TAACAGTAAC ATAAGAATAT CACTTTAGCA TGTTCCTAGA ATATGCATTC ATGATTCATC
TTCATTTACA ATGTCAATTG AGGTATATTA GTTAAAACAG TGCCAGGAAA TAGAAGGAAA TGTGGTTTCT ATGTCTTGAT
AAAAAGGAAG TATAGGCAAT TGAATCGTTG AATTATCTAC TTCTTTAGGC AGGTTACTAC CAAAAAAATA GGTCCTTTTA
TGATGATACA AACCCTAAAA ATATCTAATG CAATAGTACT GTTGATGACA CCTATGCATG CAGATATCAA ACTAAATGAA
CCAGCATTAG ATTggccaac aagagtgcga attgcccttg gcgctgcccg tggcttggaa taccttcatg agcactgcaa
ccccaagatt atccaccgcg atgtcaaggc agccaatgtc ctgcttgatg gaaactttga agcagtggta ggagactttg
ggttggcgaa gatgatagac agagagagga atacagttac gaccggggtt cgcgggacaa tgggccatat agctcctgag
tacctgaaga caggaaggcc atcagtgaag acagacatat ttggatatgg tgtaatgttg ttagaaatag tgacaggaga
gcgtgcAGTG TTCCCTGAAT TCTCGGAAGG AGACAGTGAG ATCATGCTCA ATGATCAAGT AAGATATAAT TACATTACCT
TACTATCGTT TATAGCTACC AAAGAAAGTT TAGATTGCAC ACCATTAATA ATATCTTATT AAACTAGAGA ATGGAAGCAT
ATTAAGATCA GATAAGCAAA AGCTTCTCAC CTATGTAATT GATATGAGTA GAAGTTAGGT ATAACTATGA ATGATGCTTG
ACTTATTGTA TGAACAATGC AACATAAATT TTCTGAAGAA TTAGAAAGTT GGTGTCTCAT CTTTTCACAT AGATGACCCT
GATGGGATTG ACTCTTTGGT ACATGTGAAG GTGAAAAGGT TGGTGCAAGG AGGACGATTG ACAGACATTG TGGACCACAA
CCTGGACACT GCATACGATT TGCAACAGCT GGAGAAGATG ATCCAAATAG CACTCCTCTG CACTCATGTG GAGCCTCATC
TTCGCCCTGC TATGTCAGAG GTTGTGCAGA TGCTGGAAGG CAATGTTGTC CCAGCGGAGC AATGGGAGGA GTGGCAGGTG
GCTGAACTTG CCCGGCGGCA TCAGCATGAG ATGAACCAAC AGCGCAGGCT GTTCAGCTTC AGTGAGGAGT CTCTCAATAT
CCAGGAAGCC ATTCAGCTAT CCAGTGGCAG ATAACTGGAA GATCATACAA TTGTATCACA TGAGCTTCAC TTGTTTCCCA
AGAAAGGGTG AAGGAGCGAG GAGTCTCTCA ATATCCAGGA AGACATTCAG CTATCCGGTG GCAGATAACT GGAAGATCAT
ACAATTGTAT CACATGAGCT TCACTTGTTT CCCAAGAAAG GGTGAAAGGA GACAACAGTA CTCACTATAG TTGTGGATTG
TTAGGAATAG CCTAGAGTCC TCACGGTTTG CATAAGTAAC TGTATCTAAC CTTTATGCTG TGAACACAAT GTCGTGCAGC
TACATCTCGT TCAGACATTC ATGTGTATAC ATAGACATAG ACTACAGACT ACTATAGATT ATATTCTATA GTGTTTTTGT
GTT

Locus: Os11g0607200

Loading...

Locus: Os11g0607200

Loading...