Os11t0615800-01

Locus

Os11g0615800

Description

DNA repair protein RAD51, Homologous pairing

RAP-DB Gene Symbol Synonym(s)

RAD51A1, OsRAD51A1

RAP-DB Gene Name Synonym(s)

DNA REPAIR PROTEIN RAD51A, DNA repair protein RAD51A1

CGSNL Gene Symbol

RAD51A1

CGSNL Gene Name

DNA REPAIR PROTEIN RAD51A

Oryzabase Gene Symbol Synonym(s)

OsRAD51A1

Oryzabase Gene Name Synonym(s)

DNA repair protein RAD51A1

Transcript Evidence

AB080262

Protein Evidence

Q8SBB9

Literature

PMID: 24124491

Note

Manual Curation

December 14, 2016

Gene Ontology (GO)

Biological Process: double-strand break repair via homologous recombination (GO:0000724)

Biological Process: DNA metabolic process (GO:0006259)

Biological Process: DNA repair (GO:0006281)

Biological Process: mitotic recombination-dependent replication fork processing (GO:1990426)

Molecular Function: recombinase activity (GO:0000150)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: double-stranded DNA binding (GO:0003690)

Molecular Function: single-stranded DNA binding (GO:0003697)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: DNA-dependent ATPase activity (GO:0008094)

Functional domain (InterPro)

DNA recombination and repair protein, RecA-like (IPR016467)

DNA recombination/repair protein Rad51 (IPR011941)

DNA repair Rad51/transcription factor NusA, alpha-helical (IPR010995)

DNA recombination and repair protein Rad51-like, C-terminal (IPR013632)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

DNA recombination and repair protein RecA-like, ATP-binding domain (IPR020588)

Rad51/DMC1/RadA (IPR033925)

AAA+ ATPase domain (IPR003593)

DNA recombination and repair protein RecA, monomer-monomer interface (IPR020587)

Expression Databases

TENOR (Os11t0615800-00)

RiceXPro (AB080262)

Others

Oryzabase (6789)

KEGG (Os11t0615800-00)

Transcript

1384 bp

>Os11t0615800-01 DNA repair protein RAD51, Homologous pairing
GTTGCCGCCTTCAATTCCATTCGAACGAAACGAGGAGAAGAGAGAGGAGAGAGGAGAGAG
AGGGGTTTGTGTGGCTGCGAGTGGGCCCCATGTCGACGTCGGCGGCGGCGTCGGCGGCGG
CGGAGCAGCAGCAGGAGGAGGGGGAGCACGGGCCGTTCCCCATCGAGCAGCTGCAGGCAT
CTGGAATTGCTGCTCTGGATGTGAAAAAGCTCAAGGATTCTGGTCTGTACACAGTGGAGT
CTGTGGCCTATACTCCAAGGAAAGACCTTTTGCAAATCAAAGGAATTAGTGAAGCCAAAG
TTGACAAGATAGTTGAAGCAGCATCGAAGCTAGTCCCATTGGGATTTACAAGTGCGAGCC
AACTTCATGCACAAAGGCTGGAGATTATTCAAGTTACAACTGGATCTAGAGAGCTTGATA
AGATTTTGGATGGGGGGATAGAAACTGGCTCTATCACAGAGATTTATGGTGAATTCCGAT
CAGGGAAGACTCAGCTGTGCCACACGCTGTGTGTCACATGTCAGCTTCCATTGGACCAAG
GTGGTGGTGAAGGGAAGGCTTTGTACATTGATGCAGAGGGAACATTCAGACCACAAAGGC
TGCTCCAGATAGCTGACAGGTTCGGGTTGAATGGTGCTGATGTATTAGAGAACGTGGCTT
ATGCCAGAGCTTATAATACTGATCATCAATCAAGACTTCTGCTGGAGGCAGCTTCCATGA
TGATAGAGActagGTTTGCTCTCATGATTGTAGACAGCGCGACAGCTTTGTACAGAACTG
ATTTCTCAGGTCGAGGGGAGCTCTCAGCGAGGCAAATGCACATGGCTAAGTTTCTGAGGA
GCCTTCAGAAATTAGCAGATGAGTTTGGAGTGGCTGTGGTTATCACTAATCAAGTAGTGG
CACAAGTGGATGGTTCTGCCATGTTTGCTGGGCCGCAGATCAAACCCATCGGTGGAAACA
TCATGGCTCATGCTTCCACAACAAGGCTTGCTCTTCGCAAGGGAAGAGGGGAAGAGCGAA
TATGTAAAGTGATAAGCTCTCCATGCTTGGCTGAAGCCGAAGCAAGGTTTCAGATAGCAT
CTGAAGGCGTTGCAGATGTCAAGGATTGAGACAATCTCTGCTCAGTGCTAAGCGCTAACT
GGCAACAGCTTCCCAGTTCCCACATGTGTTGCTCTCCTGCTGATTGCGCTACCACCCCTG
AAGGGTTCAACTGATGTGATGCTCCTGTTCTGAATCCGACAACCACTTATTGTCGAGTGG
AGGTGCACATCTGTGTCACTGTTGTAGTGTTGTAGTATAAAACGTTGTCTGCCCTGCAAG
GCTGCAATGCATGTAATGTGACATTGGTTTACAGATATTGAATGAATTGAAGTAAGTTTT
CTGC

CDS

1020 bp

>Os11t0615800-01 DNA repair protein RAD51, Homologous pairing
ATGTCGACGTCGGCGGCGGCGTCGGCGGCGGCGGAGCAGCAGCAGGAGGAGGGGGAGCAC
GGGCCGTTCCCCATCGAGCAGCTGCAGGCATCTGGAATTGCTGCTCTGGATGTGAAAAAG
CTCAAGGATTCTGGTCTGTACACAGTGGAGTCTGTGGCCTATACTCCAAGGAAAGACCTT
TTGCAAATCAAAGGAATTAGTGAAGCCAAAGTTGACAAGATAGTTGAAGCAGCATCGAAG
CTAGTCCCATTGGGATTTACAAGTGCGAGCCAACTTCATGCACAAAGGCTGGAGATTATT
CAAGTTACAACTGGATCTAGAGAGCTTGATAAGATTTTGGATGGGGGGATAGAAACTGGC
TCTATCACAGAGATTTATGGTGAATTCCGATCAGGGAAGACTCAGCTGTGCCACACGCTG
TGTGTCACATGTCAGCTTCCATTGGACCAAGGTGGTGGTGAAGGGAAGGCTTTGTACATT
GATGCAGAGGGAACATTCAGACCACAAAGGCTGCTCCAGATAGCTGACAGGTTCGGGTTG
AATGGTGCTGATGTATTAGAGAACGTGGCTTATGCCAGAGCTTATAATACTGATCATCAA
TCAAGACTTCTGCTGGAGGCAGCTTCCATGATGATAGAGActagGTTTGCTCTCATGATT
GTAGACAGCGCGACAGCTTTGTACAGAACTGATTTCTCAGGTCGAGGGGAGCTCTCAGCG
AGGCAAATGCACATGGCTAAGTTTCTGAGGAGCCTTCAGAAATTAGCAGATGAGTTTGGA
GTGGCTGTGGTTATCACTAATCAAGTAGTGGCACAAGTGGATGGTTCTGCCATGTTTGCT
GGGCCGCAGATCAAACCCATCGGTGGAAACATCATGGCTCATGCTTCCACAACAAGGCTT
GCTCTTCGCAAGGGAAGAGGGGAAGAGCGAATATGTAAAGTGATAAGCTCTCCATGCTTG
GCTGAAGCCGAAGCAAGGTTTCAGATAGCATCTGAAGGCGTTGCAGATGTCAAGGATTGA

Protein

340 aa

>Os11t0615800-01 DNA repair protein RAD51, Homologous pairing
MSTSAAASAAAEQQQEEGEHGPFPIEQLQASGIAALDVKKLKDSGLYTVESVAYTPRKDL
LQIKGISEAKVDKIVEAASKLVPLGFTSASQLHAQRLEIIQVTTGSRELDKILDGGIETG
SITEIYGEFRSGKTQLCHTLCVTCQLPLDQGGGEGKALYIDAEGTFRPQRLLQIADRFGL
NGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALMIVDSATALYRTDFSGRGELSA
RQMHMAKFLRSLQKLADEFGVAVVITNQVVAQVDGSAMFAGPQIKPIGGNIMAHASTTRL
ALRKGRGEERICKVISSPCLAEAEARFQIASEGVADVKD*

5'UTR

chr11:23942684..23942772 (+ strand) : 89 bp

CDS

chr11:23942773..23942859 (+ strand) : 87 bp

chr11:23944234..23944375 (+ strand) : 142 bp

chr11:23944449..23944562 (+ strand) : 114 bp

chr11:23944653..23944744 (+ strand) : 92 bp

chr11:23944831..23944925 (+ strand) : 95 bp

chr11:23945003..23945116 (+ strand) : 114 bp

chr11:23945710..23945839 (+ strand) : 130 bp

chr11:23945967..23946088 (+ strand) : 122 bp

chr11:23946182..23946305 (+ strand) : 124 bp

3'UTR

chr11:23946306..23946580 (+ strand) : 275 bp

FASTA

>Os11t0615800-01 class=Sequence position=chr11:23942684..23946580 (+ strand)
GTTGCCGCCT TCAATTCCAT TCGAACGAAA CGAGGAGAAG AGAGAGGAGA GAGGAGAGAG AGGGGTTTGT GTGGCTGCGA
GTGGGCCCCA TGTCGACGTC GGCGGCGGCG TCGGCGGCGG CGGAGCAGCA GCAGGAGGAG GGGGAGCACG GGCCGTTCCC
CATCGAGCAG CTGCAGGTAC TGGCTCGTCG TAACCCTAGC GGAGTTCTTG TGCTGTGTCT TCTCTTCTTC CGCCCCAAAT
GGGGGGTTTT CCAAGGGCGG GTGTTTCTTG GGGATTCTGA TCCGCGTAGT GGTGGGGTGG GGGGAGGGGG GAATCGTGAT
GGGTTCTTGG AGATTTGGTG TGTGGTTTAG GTTCTTGCGG TGTTGTGGGA GATTCTTGGT GGAAGAACCC TAGGTTCTTG
GAATCTTGGT TCGGTTTCTT GCCCCTGGAT GGCGTCAAGG TCGCGTCTTT CTTGGAATTA TCGCCATTTG TATGTGAAAT
TGGGACGGGT TTTTCCTGGT ATTTTTGTTG TGTTTGGGCG GATTAGGTGT TTCCGTGGAT TCTTGCCGGG GAAAGTGAAA
CCCTATGTTC CTGATTCGCC CCTTCTCCCA AATGTGTCAA GATTCAAGAA CGAGCATTTC TTGGAATTTC CTTTTGTGTT
TGCGGCTTAC GAAAGAGGGG ATATTCTCCC AGTTCTGTAT TGAAGCTGGC TATTTAGTTT CTTTTTTTTT TGCCCTTTTT
TAGGTATAGG AAACATAATC TTTATTAGGG GCATCTAGGT ATTCATGGTT CGTTCTTCCC CAAAATGGAT TAAGGTTAGG
CTTTTCTGAA ATCTGTGCAG TTTATTGTGG CGCGGTCATG ATTCGTATAA GTCCAAAGAG GGGGATTCTT GATTAGGCTT
TTGGGGAGGC GTTTCTTGGG AGTTCATAAC TTGCCTTTTC TCCCTGTATT TGGCAGTAAG ACGATTTTTA ATTCACTGTT
TAGGGCATGT GAAGCCAGCA TTTAAAATGC TAATTCTCTC AATTTGCCAT CATATTTTAA CCGTAGGCTG TCCTGTGGAT
TCTTGTGTTT TCACTTTTGG AACTTGTTTG CAAATCGGTC TGGTGGTAGG CTGTAGCAGC TTGTATTAAT TAATTTATTA
ATTCCTGAAA GCCTATTATA CGTATGATGT TTCAGGTTGT TCCTTTATGA ATAACATGTA AAAAAAAGAG GAAATCGTTG
TTTGATCATA GTACTGTTAA TATGGTAAAT AAGTTAAGAA TGGATGCACT CCTATTCCTT AGTGATATAC TATTTTCTTT
GCAATACAAG TGACCTGCTG TACAAATAAT ATCTCATGAT ATTTCTCCTC ATCAATGATG CCTAGTAGAA TTAACCATTC
TTAATGGTAG TTGCAATTGC AAGAATAAGA AGTGCCATTA TTTCTTGTAT TGTTGTATGT TCAGTACTTC AGTGCCATCT
AAAAAGCTTC TGAGGTGTAG CTAGTGACAA GCTAGTGTCT GTTTCTATGT AAAAATTATC ATAGTGATCG CTCTTCTATC
ATTAACTCTT GTGTGTAATT TGTGGTTAAG GCATCTGGAA TTGCTGCTCT GGATGTGAAA AAGCTCAAGG ATTCTGGTCT
GTACACAGTG GAGTCTGTGG CCTATACTCC AAGGAAAGAC CTTTTGCAAA TCAAAGGAAT TAGTGAAGCC AAAGTTGACA
AGATAGTTGA AGCAGGCAAG TAATTATGAG GCTCAGTACG ACTTTGTATT TCACACTGCA AAGTTCCTAA CTGTCTAAAA
TTTTACAGCA TCGAAGCTAG TCCCATTGGG ATTTACAAGT GCGAGCCAAC TTCATGCACA AAGGCTGGAG ATTATTCAAG
TTACAACTGG ATCTAGAGAG CTTGATAAGA TTTTGGATGG TATTGAACTG TTAACTTTCA TGGTTTTCTT TAATTTCTTC
AGAAATGTAC TGCTTGTGAT CATTGAGCAA TTCTATTTTG ACCAAACAGG GGGGATAGAA ACTGGCTCTA TCACAGAGAT
TTATGGTGAA TTCCGATCAG GGAAGACTCA GCTGTGCCAC ACGCTGTGTG TCACATGTCA GGTGACAGCT TATTGATCCA
ACTCTTATTT CATTGCGCAC CTGAATCCTG TTGGTAAGCT AAATTATGTT AATGATTGAT ATTGCAGCTT CCATTGGACC
AAGGTGGTGG TGAAGGGAAG GCTTTGTACA TTGATGCAGA GGGAACATTC AGACCACAAA GGCTGCTCCA GATAGCTGAC
AGGTGATTCA TTATTTATAA TGATTATTCT GTGCTCTAAC ATAAATTTGA TTGCTCAACA AGTGAAAATT GGATTGTAGG
TTCGGGTTGA ATGGTGCTGA TGTATTAGAG AACGTGGCTT ATGCCAGAGC TTATAATACT GATCATCAAT CAAGACTTCT
GCTGGAGGCA GCTTCCATGA TGATAGAGAc taggtaagtt ctaagttttt tgctctttag tttttgagtg tacctctgaa
ctctATGCTA TGTTGCATAC ACAACTTACA CCAGTATGCT TTACTTGATT TAGATATAGG TGGCCAGCAG TAGGAAACTA
AGTTGATAGT ACTTGTCCTT ATGAATCTAA GTGATTATGT AATGCCAACA AACCTTAGTT TCTGTAGTAA CCTTTTTGGC
CCGTATGACA GACTAAGTTG CACGCATCTC TTCCATCAAA ACAGAAGTGA ACTTCAGTAC TCCATTGCTG TCTATTGCTA
TAGTACTGAG TTTACACTTC AAGCAACTTG GAATGGTAGG ATGCCCAAAG TAATGGCTCA TGATTACAGA TGCTTCTATT
ATGATGAGTG GATTCGAGCT AAATTTTGTT ATGTGGTGCT TGTTATTTTC TTTCAAGGTC AACATATGTT TGATTCTGTT
TGCACAAAAT CCTTATTTAA ACATGGGAAA ATAACTGATA CATATTTCAT TGATTTTTAG TTATGGTTGT TCTTCAGACA
AGTACCTAAC ATAATATTGA ATTAGGTGTT CCTCCATAGT TCTTATTTGA ATCTTCACAT GTGCAGGTTT GCTCTCATGA
TTGTAGACAG CGCGACAGCT TTGTACAGAA CTGATTTCTC AGGTCGAGGG GAGCTCTCAG CGAGGCAAAT GCACATGGCT
AAGTTTCTGA GGAGCCTTCA GAAATTAGCA GATGAGGTTA GTTCTTTTCT ATTGTCTTTC TTTAAAGGAA ACATGGTACT
TATATCAGCA GAATAACCAT AGACCATAGT CCTTACTCTG GCATGTTTCA ATATCCTAAA TTTGGTTTGC TTACTCACTG
TAGTTTGGAG TGGCTGTGGT TATCACTAAT CAAGTAGTGG CACAAGTGGA TGGTTCTGCC ATGTTTGCTG GGCCGCAGAT
CAAACCCATC GGTGGAAACA TCATGGCTCA TGCTTCCACA ACAAGGTCCA TTACTGAGAA ACCCAATCGA ACCTGTTAAT
CCTGACTTCT TTCATGTTCC TAATTCACGT TCTTACATGC CAATACTGTG TACACCAGGC TTGCTCTTCG CAAGGGAAGA
GGGGAAGAGC GAATATGTAA AGTGATAAGC TCTCCATGCT TGGCTGAAGC CGAAGCAAGG TTTCAGATAG CATCTGAAGG
CGTTGCAGAT GTCAAGGATT GAGACAATCT CTGCTCAGTG CTAAGCGCTA ACTGGCAACA GCTTCCCAGT TCCCACATGT
GTTGCTCTCC TGCTGATTGC GCTACCACCC CTGAAGGGTT CAACTGATGT GATGCTCCTG TTCTGAATCC GACAACCACT
TATTGTCGAG TGGAGGTGCA CATCTGTGTC ACTGTTGTAG TGTTGTAGTA TAAAACGTTG TCTGCCCTGC AAGGCTGCAA
TGCATGTAAT GTGACATTGG TTTACAGATA TTGAATGAAT TGAAGTAAGT TTTCTGC

Locus: Os11g0615800

Loading...

Locus: Os11g0615800

Loading...