Os11t0620300-01

Locus

Os11g0620300

Description

Similar to Nonspecific lipid-transfer protein 2 (LTP 2).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP2.13, OsLtpII.13

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 2.13, lipid transfer protein 2.13, type 2 non-specific lipid transfer protein 13

Transcript Evidence

AK107901 (DDBJ, Best hit)

Protein Evidence

Q6ZX07 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Functional domain (InterPro)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

002-134-F08 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0620300-01)

RiceXPro (AK107901)

Others

Oryzabase (13541)

KEGG (Os11t0620300-01)

Transcript

469 bp

>Os11t0620300-01 Similar to Nonspecific lipid-transfer protein 2 (LTP 2).
ATAGAGAGAAACACAAAGGCATCAATGATGATGGGGAAGTCGTCACCATCAACGTCGCCG
GTGTACGCCGTTGCCGCCGCGCTGCTGCTTGTGTACTTGATGGTGGCCATGGGCGCCGGC
GTGGTGGAGGCGGCGGTGGTGCCACCGTCGAGGTGCAACCCGACGCTGCTGACGCCGTGC
GCGGGGCCGGCGCTGTTTGGGGGGCCGGTGCCGCCGGCATGCTGTGCACAGCTGCGGGCA
CAGGCGGCGTGCCTATGCGCGTACGCACGGAGCCCCAATTATGGTAGCTACATTAGGAGC
CCCAACGCTAGGCGTCTCTTCGCCGTCTGCGGCCTTCCCATGCCGCAGTGCTCTTAGATC
TTAATTAGCTTGCTTCGATCACACCCATGGCTATGGCTTTGGAGCTCTAGCATCATGTGC
ACAGTGTAAAATGTTGTGGCATGAATAAAATGGTTGTCATGTTTAGTTC

CDS

333 bp

>Os11t0620300-01 Similar to Nonspecific lipid-transfer protein 2 (LTP 2).
ATGATGATGGGGAAGTCGTCACCATCAACGTCGCCGGTGTACGCCGTTGCCGCCGCGCTG
CTGCTTGTGTACTTGATGGTGGCCATGGGCGCCGGCGTGGTGGAGGCGGCGGTGGTGCCA
CCGTCGAGGTGCAACCCGACGCTGCTGACGCCGTGCGCGGGGCCGGCGCTGTTTGGGGGG
CCGGTGCCGCCGGCATGCTGTGCACAGCTGCGGGCACAGGCGGCGTGCCTATGCGCGTAC
GCACGGAGCCCCAATTATGGTAGCTACATTAGGAGCCCCAACGCTAGGCGTCTCTTCGCC
GTCTGCGGCCTTCCCATGCCGCAGTGCTCTTAG

Protein

111 aa

>Os11t0620300-01 Similar to Nonspecific lipid-transfer protein 2 (LTP 2).
MMMGKSSPSTSPVYAVAAALLLVYLMVAMGAGVVEAAVVPPSRCNPTLLTPCAGPALFGG
PVPPACCAQLRAQAACLCAYARSPNYGSYIRSPNARRLFAVCGLPMPQCS*

5'UTR

chr11:24180911..24180934 (+ strand) : 24 bp

CDS

chr11:24180935..24181267 (+ strand) : 333 bp

3'UTR

chr11:24181268..24181379 (+ strand) : 112 bp

FASTA

>Os11t0620300-01 class=Sequence position=chr11:24180911..24181379 (+ strand)
ATAGAGAGAA ACACAAAGGC ATCAATGATG ATGGGGAAGT CGTCACCATC AACGTCGCCG GTGTACGCCG TTGCCGCCGC
GCTGCTGCTT GTGTACTTGA TGGTGGCCAT GGGCGCCGGC GTGGTGGAGG CGGCGGTGGT GCCACCGTCG AGGTGCAACC
CGACGCTGCT GACGCCGTGC GCGGGGCCGG CGCTGTTTGG GGGGCCGGTG CCGCCGGCAT GCTGTGCACA GCTGCGGGCA
CAGGCGGCGT GCCTATGCGC GTACGCACGG AGCCCCAATT ATGGTAGCTA CATTAGGAGC CCCAACGCTA GGCGTCTCTT
CGCCGTCTGC GGCCTTCCCA TGCCGCAGTG CTCTTAGATC TTAATTAGCT TGCTTCGATC ACACCCATGG CTATGGCTTT
GGAGCTCTAG CATCATGTGC ACAGTGTAAA ATGTTGTGGC ATGAATAAAA TGGTTGTCAT GTTTAGTTC

Locus: Os11g0620300

Loading...

Locus: Os11g0620300

Loading...