Os11t0634700-00

Locus

Os11g0634700

Description

Similar to Helix-loop-helix DNA-binding domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH132, bHLH132, OsRSL7, RSL7

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 132, ROOT HAIR DEFECTIVE-SIX LIKE 7

Transcript Evidence

ab initio prediction

Protein Evidence

Q2R0R9 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Helix-loop-helix DNA-binding (IPR011598)

Expression Databases

TENOR (Os11t0634700-00)

Others

Oryzabase (15410)

Transcript

1080 bp

>Os11t0634700-00 Similar to Helix-loop-helix DNA-binding domain containing protein.
ATGAGGGGCACACAATCAACGGTAGAACTAACCTATTTCGTCGACTGCTTAACGACGACG
AGCTTGCAGACGCCATGGCTGCTCGCCGCCTCCAGCCTCAACCTCGCCGACTCCGGCCGC
AACCAACCCGTCTCCGACCGCTACCTCCTCGTTCCGCACTTCGCCGCCGCACACCGTCCC
CTCGTCGCCTCACCCGCTTCAGCCACTAACCCTAGTGCTCACAGAAACAATTCCAAGAGA
TCACACATTACAACTCTTTTCAAAAGATCACAAATTAGAGCTTGGAAGTTTCAGATCAAT
AGGATGGATGCAAGGTGTGCAAACATCTGGAGCTCTGCTGATGCAAGGAGTGAGGAATCT
GAGATGATTGATCAACTAAAGTCCATGTTCTGGAGCAGCACTGATGCTGAAATCAACTTT
TATTCTCCTGACAGTAGTGTAAATTCTTGTGTCACAACTAGCACAATGCCTAGCAGCTTG
TTTCTTCCTCTGATGGATGATGAGGGATTTGGCACAGTGCAATTGATGGTTAGCACTGGC
ATGGATATGTGTTCTGATCATCAGCATCAGGTCATCACTGGGAACAAGAGGATGTTCCCC
ATGGATGAGCACTTTGAGCAGCAGCAGAAGAAGCCGAAGAAGAAAACCCGAACTTCTCGC
TCGGTATCAAGTAGTTCAACCATTACTGACTATGAGACTAGCTCTGAACTTGTCAATCCT
AGCTGTTCCTCCGGGAGCAGCGTCGGAGAGGATTCAATTGCTGCAACTGATGGATCTGTA
GTGCTGAAACAAAGTGACAATTCAAGAGGCCATAAGCAGTGCTCCAAGGATACACAAAGC
CTCTATGCTAAGAGGAGAAGGGAAAGGATTAATGAGAGACTGAGAATACTTCAGCAGCTT
GTTCCCAATGGCACTAAAGTTGACATCAGCACAATGCTGGAGGAAGCAGTTCAGTATGTC
AAGTTTTTGCAGTTGCAAATAAAGCTATTGAGCTCTGACGACACATGGATGTTTGCGCCC
CTAGCCTATAATGGCATGAACATGGATCTCGGTCATACTCTTGCTGAAAACCAAGAATGA

CDS

1080 bp

>Os11t0634700-00 Similar to Helix-loop-helix DNA-binding domain containing protein.
ATGAGGGGCACACAATCAACGGTAGAACTAACCTATTTCGTCGACTGCTTAACGACGACG
AGCTTGCAGACGCCATGGCTGCTCGCCGCCTCCAGCCTCAACCTCGCCGACTCCGGCCGC
AACCAACCCGTCTCCGACCGCTACCTCCTCGTTCCGCACTTCGCCGCCGCACACCGTCCC
CTCGTCGCCTCACCCGCTTCAGCCACTAACCCTAGTGCTCACAGAAACAATTCCAAGAGA
TCACACATTACAACTCTTTTCAAAAGATCACAAATTAGAGCTTGGAAGTTTCAGATCAAT
AGGATGGATGCAAGGTGTGCAAACATCTGGAGCTCTGCTGATGCAAGGAGTGAGGAATCT
GAGATGATTGATCAACTAAAGTCCATGTTCTGGAGCAGCACTGATGCTGAAATCAACTTT
TATTCTCCTGACAGTAGTGTAAATTCTTGTGTCACAACTAGCACAATGCCTAGCAGCTTG
TTTCTTCCTCTGATGGATGATGAGGGATTTGGCACAGTGCAATTGATGGTTAGCACTGGC
ATGGATATGTGTTCTGATCATCAGCATCAGGTCATCACTGGGAACAAGAGGATGTTCCCC
ATGGATGAGCACTTTGAGCAGCAGCAGAAGAAGCCGAAGAAGAAAACCCGAACTTCTCGC
TCGGTATCAAGTAGTTCAACCATTACTGACTATGAGACTAGCTCTGAACTTGTCAATCCT
AGCTGTTCCTCCGGGAGCAGCGTCGGAGAGGATTCAATTGCTGCAACTGATGGATCTGTA
GTGCTGAAACAAAGTGACAATTCAAGAGGCCATAAGCAGTGCTCCAAGGATACACAAAGC
CTCTATGCTAAGAGGAGAAGGGAAAGGATTAATGAGAGACTGAGAATACTTCAGCAGCTT
GTTCCCAATGGCACTAAAGTTGACATCAGCACAATGCTGGAGGAAGCAGTTCAGTATGTC
AAGTTTTTGCAGTTGCAAATAAAGCTATTGAGCTCTGACGACACATGGATGTTTGCGCCC
CTAGCCTATAATGGCATGAACATGGATCTCGGTCATACTCTTGCTGAAAACCAAGAATGA

Protein

360 aa

>Os11t0634700-00 Similar to Helix-loop-helix DNA-binding domain containing protein.
MRGTQSTVELTYFVDCLTTTSLQTPWLLAASSLNLADSGRNQPVSDRYLLVPHFAAAHRP
LVASPASATNPSAHRNNSKRSHITTLFKRSQIRAWKFQINRMDARCANIWSSADARSEES
EMIDQLKSMFWSSTDAEINFYSPDSSVNSCVTTSTMPSSLFLPLMDDEGFGTVQLMVSTG
MDMCSDHQHQVITGNKRMFPMDEHFEQQQKKPKKKTRTSRSVSSSSTITDYETSSELVNP
SCSSGSSVGEDSIAATDGSVVLKQSDNSRGHKQCSKDTQSLYAKRRRERINERLRILQQL
VPNGTKVDISTMLEEAVQYVKFLQLQIKLLSSDDTWMFAPLAYNGMNMDLGHTLAENQE*

CDS

chr11:24980227..24980441 (+ strand) : 215 bp

chr11:24982830..24983277 (+ strand) : 448 bp

chr11:24983351..24983539 (+ strand) : 189 bp

chr11:24983624..24983689 (+ strand) : 66 bp

chr11:24983805..24983870 (+ strand) : 66 bp

chr11:24984154..24984249 (+ strand) : 96 bp

FASTA

>Os11t0634700-00 class=Sequence position=chr11:24980227..24984249 (+ strand)
ATGAGGGGCA CACAATCAAC GGTAGAACTA ACCTATTTCG TCGACTGCTT AACGACGACG AGCTTGCAGA CGCCATGGCT
GCTCGCCGCC TCCAGCCTCA ACCTCGCCGA CTCCGGCCGC AACCAACCCG TCTCCGACCG CTACCTCCTC GTTCCGCACT
TCGCCGCCGC ACACCGTCCC CTCGTCGCCT CACCCGCTTC AGCCACTAAC CCTAGGTGTG GAAGAATGGG AGGGATGCGA
TGGATTAGGG GATTTTTGTG CTGCCCAGGA AACTGCTGTT GCGGAGGGGG GGTATCTGCA AAACGGGTGC TTGcgtggcg
tgccacgtcg gcggtccgag ccggtcaagt ggggtttgga cctgctatgt atcattaaac caagttggtg gatttgactg
tgcaatttac aagattgtgg acctaagtga cacccacgct taagtttaag gaccggccat atattttact ctTTTAGTTT
TGGATGTACC AACACCTTTC TCGAAGATTT GGCTGTATTT TGTAGAGAAT GACAGATCAA CAGTACCCTT TTAGTGTTGT
GAATCAGGAA AGGATGGGAA GCTGCATCCC ATTTGTCAAA GATTTTGTTG GCCTTCTGCA ATGAGATGTA GCCATGCACA
TAGCCACATA GCTGTGAGGA AAAATGTTAT CTTTTCTTCC TTTTGTCATC TGGGGTGGTC CAGAAAAAAC ATTATTTGCT
GCAGCTTGCA TGACAGATGG CAATATATGA TAATGCTATA TCACCTCTAT CAAAGAAGTG TGCTGAGGTG ATAAAATCTT
GTTATGCATG TTTGGAATAA GATGGCTGTC TACTCACTGT TTAGATGCAC TTTATTTTCT TACATTATCA GCGTGAATCT
TGAAGCTGTA CTTATCTGTG TGAGATTGCT GTCATACTCT TGATGTATAG ATCTTGCAGG GAAATTGTGT TTCGTGCGCC
ATAAAATTTT GACACTTTTA GGACTATTTT GTTGGCATAC AAGGCTATTG AACGTTTTGA GTATGAAAGC ATAGCATTTG
ATGTGGTCTT CTTGCATGAA ACAGAGTTCA TTGGGTTGGT GAAATCGGAG TTCTTTCTGT TTCTTGTCTT CGTGCATAAT
GATGATTCAG GCTTTGATGT GACTTCAAAC CTTGGGAATT TAGTGCCTTT TTGTTGGACT AGAGTACTGG CTGATTCTAT
TTGAGGGCAT ATAAAGCATA ATACTAATCT CTACTTGTTG TAAGACCACA AATTTAGCTG TCATTTCATA AATGATCTTG
CATCCATTTA CTATGGACTG ACAGAACACA GTCCAGTTGA ATTGAATAAA GTGCTAATTG GCCTATTAAG TTGACACCTT
TTTTTTTTTC TAATAATGTC TTTTTTATAT AATTATGTCT TCTTCCTTCT GTTCTCTGTT CTGTTTTCTA CATCAGATTG
CATGTTTATT GTCTTGCAAG TTGGCATTGC ATTCTGGTTT CTTGGTTGCA CTATATTGTC AAAGTGTACT CCATCTTTGC
ATCATGGAGA TCTGAAGATT TTATATAGTT AATGTGATAT TGTACTAAGC CCCCATTGAA ATCAGTTATA TCTGGCTAAT
GAAATGATTG GCATTGGGTC ATTAAATTCC TGGAGATCCT TTCAAGTGGC AGTATGTTAC CCCAGATGAA GTCTGAAGGA
CAGCTAGCTT GTATTTGTGA ATGCAATGAT GAACTTGGTC CATTTTATTG CACATATTCA AGATGTATGT AGTGATTTGT
GAATCTAACC AGATATTTGT TTGTGCAGCT TAATTAATGC CAGATGCAAC ATTAATGCTC ATGGAAGCCA TCCTTGCATG
CTTAATACAA ACATTAAGCA CGTCTTGAGC TGTCCTATTA TACAAGTACA ACAGAATAAA GAACAATTAA GTGACATCAT
ATTCATGGCT TCACCTTATT TGTTCACATA GCATTTCAAT TCAGTATGTA GATAGACTTG CACAATGTGA ATTACTGAAT
TGCACAACTA GGATTAGTTA CTTATGTACA TTATTATAGC AAAGGGTATG GCATGCCATA CTGTTCTTCA CTATCCTCTT
TAAGTCACCA AGAAAGAAAA TGTGAAGCTG CCAAACTGAG TTTGATATCA GTTGTGTCCT ATTTTATTTA TAACATTGCC
AGCACTTCTT CTCCATGATC ACCTCCCTCC AAATTTCTTA TTTGTGGCCA GCTCTTATTA TTTTCTTATA AGTGGTGTTG
ATGTTTTTTT GTGTCGTATT ATCGGCTATT GATCTTGCGA CTTAATTGCC GATCATATGA ATCATTTAAT GTTATCATAT
AATTAACCTT GTTAGTTGTT TTTCTTTTTC CTCCCTCTCA CCTCAACCAA AAGTCTATAT AGCATGCCTC TTTAGATTTC
TCAATGGGCA ATCGATTCCC CATATAATCT TTCTATCATT TGAAGATCCT GAGGGTATGG GTCATGGAAC TTGCGATATA
AAGTACTAGC TCTTAGTTGT CATTTGTACA TAAAGATAAG ATTATGATGG AACCTTAGTC AAATTTATAT CTGCAGATGA
TTCTCTGGAA ACATAGTATA AATTTGTGCC CCTACCTGCA CAGTGCTCAC AGAAACAATT CCAAGAGATC ACACATTACA
ACTCTTTTCA AAAGATCACA AATTAGAGCT TGGAAGTTTC AGATCAATAG GATGGATGCA AGGTGTGCAA ACATCTGGAG
CTCTGCTGAT GCAAGGAGTG AGGAATCTGA GATGATTGAT CAACTAAAGT CCATGTTCTG GAGCAGCACT GATGCTGAAA
TCAACTTTTA TTCTCCTGAC AGTAGTGTAA ATTCTTGTGT CACAACTAGC ACAATGCCTA GCAGCTTGTT TCTTCCTCTG
ATGGATGATG AGGGATTTGG CACAGTGCAA TTGATGGTTA GCACTGGCAT GGATATGTGT TCTGATCATC AGCATCAGGT
CATCACTGGG AACAAGAGGA TGTTCCCCAT GGATGAGCAC TTTGAGCAGC AGCAGAAGAA GCCGAAGAAG AAAACCCGAA
CTTCTCGCTC GGTAGGTCAA TTTGGCATGA GAATTTTGGT TCATGCTTAA ACTGTTGTAA TGACTAAAAT TCATTTTATT
TTAGGTATCA AGTAGTTCAA CCATTACTGA CTATGAGACT AGCTCTGAAC TTGTCAATCC TAGCTGTTCC TCCGGGAGCA
GCGTCGGAGA GGATTCAATT GCTGCAACTG ATGGATCTGT AGTGCTGAAA CAAAGTGACA ATTCAAGAGG CCATAAGCAG
TGCTCCAAGG ATACACAAAG CCTCTATGCT AAGGTTAGGA CCTAATTGTG TTATTAATTT GTCTAATGTT TGAATCTGAA
GTATTTTTTC TGACGGCGTT TCTGACCATC TTAACAGAGG AGAAGGGAAA GGATTAATGA GAGACTGAGA ATACTTCAGC
AGCTTGTTCC CAATGGCACT AAAGTAAGCT TTTGCTGATT AGTATTTAGT AATTATCTTA CTAGTTTGGT GAACAGAACA
ATCAATGTAG TAAGTTTGAG TGCATCAATG AATAATGTAA TCTGTCTCCC ATTTTCAGGT TGACATCAGC ACAATGCTGG
AGGAAGCAGT TCAGTATGTC AAGTTTTTGC AGTTGCAAAT AAAGGTACTA GTTATGTTAC AGTAAAATCA AATCAACAGA
AGGATACAAA ATCATAGATT TTGTAGAAAA AGGGTACTTC ATGGCTGCAA GTACATTAAT AAAGGCAATT TCACTACACA
TTTTAGAATG TTCCCTGGTT TCACAGCACT TTCAGAATAC ATGTACTAGA ACATTCAGAA TGCAAAATGA AAGAAGAATC
AATTCTGCTT AATCTTTTGT GTTACACATT ATGCATTCGA AAGATGTATA TATCTTTTAT CTGATCTTCT TTCAATTTTC
TAAACAGCTA TTGAGCTCTG ACGACACATG GATGTTTGCG CCCCTAGCCT ATAATGGCAT GAACATGGAT CTCGGTCATA
CTCTTGCTGA AAACCAAGAA TGA

Locus: Os11g0634700

Loading...

Locus: Os11g0634700

Loading...