Os11t0646300-00

Locus

Os11g0646300

Description

NB-ARC domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

ab initio prediction

Protein Evidence

B9FNG0 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

NB-ARC (IPR002182)

Expression Databases

TENOR (Os11t0646300-00)

Transcript

3933 bp

>Os11t0646300-00 NB-ARC domain containing protein.
ATGGACCAGAGCGCGGTGAGCTCGCTGCTGGGGCAGCTTACCGGCCTCCTCGTTGACGAG
GCGAAGCTACTCGGCGGCGTCCGGGGCGACGTGCAATTCATCAAGGACGAGATGGAGAGC
ATGCAAGGCTTCCTCCTGGATGCCGCCGATGCCGCCAACAACAACAGCAGCAGCCAGCAG
GTCCTGGCATGGCAGCGGCaggtccgggaggtcgcctacgactcccagaaatgcatcgac
cactacgtgcagacggtgggcgccagccgcccgtcggccggcctcctcggctccgtccag
tggctgccgcagctggtgatgacgttgccaagccgccagcgcaccgccaacaagatcaag
aagctcaaggcccgcgcgcgcgaggtgggggagcggcggcagaggtacggcgtcaaagct
ccgactcggagcggcggcgtcaaggtcatcaccgcgccgatgctctcgccGCAGCAGGAG
GCGGCGGAGCACGCGCGGAGGCGCCGTGCCATAGCTGACGCCACCGACTGGGTGAACACC
GACGCGCAGCACGTGATGGACTGGATAGCGGCCGGCGGCAAAGGACACAACGACGATGAT
GGTGGCCGGGAGGAGTACATACATTGGATCAAAGGCTTCCTGCACATGCCCCACTTCACC
ACCGAGAGCTTCTTGACGGAGCTCATGAGCAACAAGGCCGATGCTACCGCCTTCTTGCTG
GAGTACACCAAAGAGTTGTTCGGAGGGCCGCTCCACTATTTGGAAGGGCATTTGTTGTGG
CCACATAAAGATGATGGGCATGATAAGAAGGCCACGACGGCAGCGGCATCATCCCCTTCT
CAAGACCACCACGATGCTGACAAAAAGAAGCCAGTAGCAGCTGCTGATCCGTCAGAGAGG
GCCAAAGAAGCAGCTGTTGATCCGTCTGGGAAGGCGAAGGAGCACAAGCGTTGGATCACC
CAAGGGGAGAAGAAAGCGGCGGACACGTCAACCTCTTCAGAAGTCCATGATTCTGCTGAG
AAGAGGATGCCTTTAGCAGATGTTAATCCGTCGGAGATGGCGGAAGCATCATCAGCTGAT
GATGGACATAACAAGGCAACGGAAGGCCATACCAAAGAGTTGTTCGGAGGGCCGCTCCAC
TATTTGAAAGGGCATTTGTTGTGGCCACATAAAGATGATGGGCATGATAAGAAGGCCACG
ACGGCAGCGGCATCATCCCCTTCTCAAGACCACCACGATGCTGACAAAAAGAAGCCAGTA
GCAGCTGCTGATCCGTCAGAGAGGGCCAAAGAGGAGAAGAAGCACCAGATCATCAGTTGG
GTACATGGAGCACTTACGAGCGACGGCATCAACATATTTCACACGAAAGATACCCACGGC
CCAAGGCTCCTCGCCATTGTTACATCACCGGTTCGTCGCGAGGCCCACGACCTCGAAGAC
GAAGAACCACATGGGCTCAGGCCTGCAACAGAGATCGCACGTAGGGTGTTCAATAATTAT
TATTCCCGCCAAGGCGGCCGCTTCGACTTTGCCGTGTGGGTCAACGCCGAGGAACACTCA
CATAGCACCGCCAGGCTTCGGAGCATACTCCAGCAGGTGGAGAAGCAGGCGCAGGTGCAG
CCTCAGGAGCAGCGGCAGCATCCATCATCTTCTTCTCGCGATAAAAAAGACGGTGGTGAC
GAGACGACAAGATTGCAACAGGAGATCCTAAAGCACCTGACAGGGAAGAAGTTCTTGATT
TTTCTTGCTGACCACCAGGACGAAACACCATGGACACAGATACTACCTGCTCTGCCGACT
GATAGCACCAATGAAAGTGCAGTCATATTGAGTCCTCTGGTGCAGCAAGCATACCAGTAC
GTTGGGTGGTACGTGCTCAGCCTTTTCTTCTTGCTAAAGCACTCCCGCTATAGAGTCTAC
TTCTACTCTCATCTTGTTGCAACACGGAACAAGGCCAAAGAGTTGCTGCGGGTTGGCGCC
GATCAACACAAAGGAGAAGATTTGCATGACCTCGTCAATCATATATTGGAACGTTGTCGC
TGGGATTCATTTTCCAGCAAGATGTTTCTTCATGCTCTTTATGCTAATCATCAAAGGAGC
AAGCCAGAGCTGGAGAACTTGTTGCTTTCTCTGAATGAATTCAGCACGGTGAGCAATGCC
AGAAACATGATCAAATTTTGCTACGATGACCTGCACAGTTACAAGGTTTGCTTCCAGTAC
CTGTCCATTTTCCCCTTGGGATTCAAGATCAGGAGGACAAGCTTGGTCAGGCGATGGGCT
GCAGAAGGCCTTATCGTGGGAAGAGACGGGCTAGCTGCAACGGATGAAGCTGAGCGCTGC
TTCGATGCCATGATTGATCGAGGCCTTCTCCTTCCTGCCGACAACACCGACAACCCTTCA
GGCAAAGTGAAGATGTGCACGGTCGATCCACATGTTTTCTCCTTCATTGCCAGGTTGCAC
AAAGACGATGGCCGTGCTCCAGCTGCTGATAGCATCGACCTGCCGCCCGCCCTGGCTCAT
CGCATCTCCATTGCCAGAAGAATTCAACTCTCCAACAAGACACGACAACGAGTCAGCGAG
GGTTTGAAGAAGCAGATGGACGGCGGTGGCGAGCCACAAGACTCTGTCGCACAAGGCATG
GTCTGTGGAATTCAACTTTCCAACAAGACACGACGACGACAAGCCAGTGAGGGGTTGAAG
AAGAAGATGGACAGCAATGGGGAGCCACTAGTCCCAGAGCCAAGATCGCAAGACTCTGCA
GTGGAAGACGTGGTAAAGCTTCTTGACTTGTTTCCTACAACTGAATCAGGATGGATCAAA
GTGCTAGACCTTGAAGGCTGCCGTGGACTGAAGAAGAAGCACCTCAAGAACATCTGCAAC
AGGGTATTCCAGCTCAAGTATCTGAGCTTAAGGAACACAGACATTGCTGAGCTGCCCAAG
GAAATTAACAAGCTCCAAGACCTGGAGACATTTGACATGAGGGGAACCAACATAGAATCC
TTCCCTGCAAAATCCATTGTTCTCCCAAAGCTGGCGCGACTGCTTTCTGGTGTTGCTCAC
ACCGACGCTCCAACTCCAAGTAAGGATGATAATCTTACAAGTAGAGGATCTTCTCATGAA
TCATTTACTGCAATCCATATTCCCCGTGGAATCAAGAACATGACAAGCATGCAGATACTA
TCCCATGTCCAAGTTTCTGACCATCACGACGAGGCTGCAGCACTGGAAGATTTAGCCCGG
CTGCAGCTGCTATGGAAGCTTGGTGTTGTTATCCATGCCAAGCAAGCTTACCTTGTGCTC
AAAGTGGTTGGGATGCTAAATGAATGCCTGAGGTCTTTGTCAATCCGTCTCCAAGATGGT
GGAGAGGATCCTGATCTGAACAACACACCACCAATATTCTCACCTCCAAGATCTCTTGCA
AGCCTTAGCATCAGTGGCAGGATAGGTGGCCTGCCTACTTGGATCCAAAATCTGGAACAA
CTCTCTGACATAACTCTGTGCGACACCTCCTTGAAAGACTCTGATATAAAGATCTTGTGT
GCTAGTATCAACCTGCGCTTCATCAGGCTCTTGCGTGAGTCGTACAACCAGAACAAGCTC
AGTTTTGAAAAGGGATTCAGAAACCTTGAGATTCTCATCATTGAGGGATCAGGCACCATC
TCTGATGTCCATTTTGATCCGAGAGTGGCACCTAAGCTTGAGAAGATTGTCTGGAGCTCC
ACCTGCAAGATGGAAAATCTTGGGATCGACAACCTTCAAGGACTGAAAGAGATTGTGCTC
AAAGGCGACTGTGACCTGAATCGCATCAGGCTATCCGTCAAAGCGAATCCATGCCATCCT
AACCTTACACACACTCCAACTCTCAACTCTCCAACAATCCAACCCGGTGAGGACACTGCA
GCTGCAACCAGCACTTCGGCAACAAACAAGTAG

CDS

3933 bp

>Os11t0646300-00 NB-ARC domain containing protein.
ATGGACCAGAGCGCGGTGAGCTCGCTGCTGGGGCAGCTTACCGGCCTCCTCGTTGACGAG
GCGAAGCTACTCGGCGGCGTCCGGGGCGACGTGCAATTCATCAAGGACGAGATGGAGAGC
ATGCAAGGCTTCCTCCTGGATGCCGCCGATGCCGCCAACAACAACAGCAGCAGCCAGCAG
GTCCTGGCATGGCAGCGGCaggtccgggaggtcgcctacgactcccagaaatgcatcgac
cactacgtgcagacggtgggcgccagccgcccgtcggccggcctcctcggctccgtccag
tggctgccgcagctggtgatgacgttgccaagccgccagcgcaccgccaacaagatcaag
aagctcaaggcccgcgcgcgcgaggtgggggagcggcggcagaggtacggcgtcaaagct
ccgactcggagcggcggcgtcaaggtcatcaccgcgccgatgctctcgccGCAGCAGGAG
GCGGCGGAGCACGCGCGGAGGCGCCGTGCCATAGCTGACGCCACCGACTGGGTGAACACC
GACGCGCAGCACGTGATGGACTGGATAGCGGCCGGCGGCAAAGGACACAACGACGATGAT
GGTGGCCGGGAGGAGTACATACATTGGATCAAAGGCTTCCTGCACATGCCCCACTTCACC
ACCGAGAGCTTCTTGACGGAGCTCATGAGCAACAAGGCCGATGCTACCGCCTTCTTGCTG
GAGTACACCAAAGAGTTGTTCGGAGGGCCGCTCCACTATTTGGAAGGGCATTTGTTGTGG
CCACATAAAGATGATGGGCATGATAAGAAGGCCACGACGGCAGCGGCATCATCCCCTTCT
CAAGACCACCACGATGCTGACAAAAAGAAGCCAGTAGCAGCTGCTGATCCGTCAGAGAGG
GCCAAAGAAGCAGCTGTTGATCCGTCTGGGAAGGCGAAGGAGCACAAGCGTTGGATCACC
CAAGGGGAGAAGAAAGCGGCGGACACGTCAACCTCTTCAGAAGTCCATGATTCTGCTGAG
AAGAGGATGCCTTTAGCAGATGTTAATCCGTCGGAGATGGCGGAAGCATCATCAGCTGAT
GATGGACATAACAAGGCAACGGAAGGCCATACCAAAGAGTTGTTCGGAGGGCCGCTCCAC
TATTTGAAAGGGCATTTGTTGTGGCCACATAAAGATGATGGGCATGATAAGAAGGCCACG
ACGGCAGCGGCATCATCCCCTTCTCAAGACCACCACGATGCTGACAAAAAGAAGCCAGTA
GCAGCTGCTGATCCGTCAGAGAGGGCCAAAGAGGAGAAGAAGCACCAGATCATCAGTTGG
GTACATGGAGCACTTACGAGCGACGGCATCAACATATTTCACACGAAAGATACCCACGGC
CCAAGGCTCCTCGCCATTGTTACATCACCGGTTCGTCGCGAGGCCCACGACCTCGAAGAC
GAAGAACCACATGGGCTCAGGCCTGCAACAGAGATCGCACGTAGGGTGTTCAATAATTAT
TATTCCCGCCAAGGCGGCCGCTTCGACTTTGCCGTGTGGGTCAACGCCGAGGAACACTCA
CATAGCACCGCCAGGCTTCGGAGCATACTCCAGCAGGTGGAGAAGCAGGCGCAGGTGCAG
CCTCAGGAGCAGCGGCAGCATCCATCATCTTCTTCTCGCGATAAAAAAGACGGTGGTGAC
GAGACGACAAGATTGCAACAGGAGATCCTAAAGCACCTGACAGGGAAGAAGTTCTTGATT
TTTCTTGCTGACCACCAGGACGAAACACCATGGACACAGATACTACCTGCTCTGCCGACT
GATAGCACCAATGAAAGTGCAGTCATATTGAGTCCTCTGGTGCAGCAAGCATACCAGTAC
GTTGGGTGGTACGTGCTCAGCCTTTTCTTCTTGCTAAAGCACTCCCGCTATAGAGTCTAC
TTCTACTCTCATCTTGTTGCAACACGGAACAAGGCCAAAGAGTTGCTGCGGGTTGGCGCC
GATCAACACAAAGGAGAAGATTTGCATGACCTCGTCAATCATATATTGGAACGTTGTCGC
TGGGATTCATTTTCCAGCAAGATGTTTCTTCATGCTCTTTATGCTAATCATCAAAGGAGC
AAGCCAGAGCTGGAGAACTTGTTGCTTTCTCTGAATGAATTCAGCACGGTGAGCAATGCC
AGAAACATGATCAAATTTTGCTACGATGACCTGCACAGTTACAAGGTTTGCTTCCAGTAC
CTGTCCATTTTCCCCTTGGGATTCAAGATCAGGAGGACAAGCTTGGTCAGGCGATGGGCT
GCAGAAGGCCTTATCGTGGGAAGAGACGGGCTAGCTGCAACGGATGAAGCTGAGCGCTGC
TTCGATGCCATGATTGATCGAGGCCTTCTCCTTCCTGCCGACAACACCGACAACCCTTCA
GGCAAAGTGAAGATGTGCACGGTCGATCCACATGTTTTCTCCTTCATTGCCAGGTTGCAC
AAAGACGATGGCCGTGCTCCAGCTGCTGATAGCATCGACCTGCCGCCCGCCCTGGCTCAT
CGCATCTCCATTGCCAGAAGAATTCAACTCTCCAACAAGACACGACAACGAGTCAGCGAG
GGTTTGAAGAAGCAGATGGACGGCGGTGGCGAGCCACAAGACTCTGTCGCACAAGGCATG
GTCTGTGGAATTCAACTTTCCAACAAGACACGACGACGACAAGCCAGTGAGGGGTTGAAG
AAGAAGATGGACAGCAATGGGGAGCCACTAGTCCCAGAGCCAAGATCGCAAGACTCTGCA
GTGGAAGACGTGGTAAAGCTTCTTGACTTGTTTCCTACAACTGAATCAGGATGGATCAAA
GTGCTAGACCTTGAAGGCTGCCGTGGACTGAAGAAGAAGCACCTCAAGAACATCTGCAAC
AGGGTATTCCAGCTCAAGTATCTGAGCTTAAGGAACACAGACATTGCTGAGCTGCCCAAG
GAAATTAACAAGCTCCAAGACCTGGAGACATTTGACATGAGGGGAACCAACATAGAATCC
TTCCCTGCAAAATCCATTGTTCTCCCAAAGCTGGCGCGACTGCTTTCTGGTGTTGCTCAC
ACCGACGCTCCAACTCCAAGTAAGGATGATAATCTTACAAGTAGAGGATCTTCTCATGAA
TCATTTACTGCAATCCATATTCCCCGTGGAATCAAGAACATGACAAGCATGCAGATACTA
TCCCATGTCCAAGTTTCTGACCATCACGACGAGGCTGCAGCACTGGAAGATTTAGCCCGG
CTGCAGCTGCTATGGAAGCTTGGTGTTGTTATCCATGCCAAGCAAGCTTACCTTGTGCTC
AAAGTGGTTGGGATGCTAAATGAATGCCTGAGGTCTTTGTCAATCCGTCTCCAAGATGGT
GGAGAGGATCCTGATCTGAACAACACACCACCAATATTCTCACCTCCAAGATCTCTTGCA
AGCCTTAGCATCAGTGGCAGGATAGGTGGCCTGCCTACTTGGATCCAAAATCTGGAACAA
CTCTCTGACATAACTCTGTGCGACACCTCCTTGAAAGACTCTGATATAAAGATCTTGTGT
GCTAGTATCAACCTGCGCTTCATCAGGCTCTTGCGTGAGTCGTACAACCAGAACAAGCTC
AGTTTTGAAAAGGGATTCAGAAACCTTGAGATTCTCATCATTGAGGGATCAGGCACCATC
TCTGATGTCCATTTTGATCCGAGAGTGGCACCTAAGCTTGAGAAGATTGTCTGGAGCTCC
ACCTGCAAGATGGAAAATCTTGGGATCGACAACCTTCAAGGACTGAAAGAGATTGTGCTC
AAAGGCGACTGTGACCTGAATCGCATCAGGCTATCCGTCAAAGCGAATCCATGCCATCCT
AACCTTACACACACTCCAACTCTCAACTCTCCAACAATCCAACCCGGTGAGGACACTGCA
GCTGCAACCAGCACTTCGGCAACAAACAAGTAG

Protein

1311 aa

>Os11t0646300-00 NB-ARC domain containing protein.
MDQSAVSSLLGQLTGLLVDEAKLLGGVRGDVQFIKDEMESMQGFLLDAADAANNNSSSQQ
VLAWQRQVREVAYDSQKCIDHYVQTVGASRPSAGLLGSVQWLPQLVMTLPSRQRTANKIK
KLKARAREVGERRQRYGVKAPTRSGGVKVITAPMLSPQQEAAEHARRRRAIADATDWVNT
DAQHVMDWIAAGGKGHNDDDGGREEYIHWIKGFLHMPHFTTESFLTELMSNKADATAFLL
EYTKELFGGPLHYLEGHLLWPHKDDGHDKKATTAAASSPSQDHHDADKKKPVAAADPSER
AKEAAVDPSGKAKEHKRWITQGEKKAADTSTSSEVHDSAEKRMPLADVNPSEMAEASSAD
DGHNKATEGHTKELFGGPLHYLKGHLLWPHKDDGHDKKATTAAASSPSQDHHDADKKKPV
AAADPSERAKEEKKHQIISWVHGALTSDGINIFHTKDTHGPRLLAIVTSPVRREAHDLED
EEPHGLRPATEIARRVFNNYYSRQGGRFDFAVWVNAEEHSHSTARLRSILQQVEKQAQVQ
PQEQRQHPSSSSRDKKDGGDETTRLQQEILKHLTGKKFLIFLADHQDETPWTQILPALPT
DSTNESAVILSPLVQQAYQYVGWYVLSLFFLLKHSRYRVYFYSHLVATRNKAKELLRVGA
DQHKGEDLHDLVNHILERCRWDSFSSKMFLHALYANHQRSKPELENLLLSLNEFSTVSNA
RNMIKFCYDDLHSYKVCFQYLSIFPLGFKIRRTSLVRRWAAEGLIVGRDGLAATDEAERC
FDAMIDRGLLLPADNTDNPSGKVKMCTVDPHVFSFIARLHKDDGRAPAADSIDLPPALAH
RISIARRIQLSNKTRQRVSEGLKKQMDGGGEPQDSVAQGMVCGIQLSNKTRRRQASEGLK
KKMDSNGEPLVPEPRSQDSAVEDVVKLLDLFPTTESGWIKVLDLEGCRGLKKKHLKNICN
RVFQLKYLSLRNTDIAELPKEINKLQDLETFDMRGTNIESFPAKSIVLPKLARLLSGVAH
TDAPTPSKDDNLTSRGSSHESFTAIHIPRGIKNMTSMQILSHVQVSDHHDEAAALEDLAR
LQLLWKLGVVIHAKQAYLVLKVVGMLNECLRSLSIRLQDGGEDPDLNNTPPIFSPPRSLA
SLSISGRIGGLPTWIQNLEQLSDITLCDTSLKDSDIKILCASINLRFIRLLRESYNQNKL
SFEKGFRNLEILIIEGSGTISDVHFDPRVAPKLEKIVWSSTCKMENLGIDNLQGLKEIVL
KGDCDLNRIRLSVKANPCHPNLTHTPTLNSPTIQPGEDTAAATSTSATNK*

CDS

chr11:25695249..25699181 (+ strand) : 3933 bp

FASTA

>Os11t0646300-00 class=Sequence position=chr11:25695249..25699181 (+ strand)
ATGGACCAGA GCGCGGTGAG CTCGCTGCTG GGGCAGCTTA CCGGCCTCCT CGTTGACGAG GCGAAGCTAC TCGGCGGCGT
CCGGGGCGAC GTGCAATTCA TCAAGGACGA GATGGAGAGC ATGCAAGGCT TCCTCCTGGA TGCCGCCGAT GCCGCCAACA
ACAACAGCAG CAGCCAGCAG GTCCTGGCAT GGCAGCGGCa ggtccgggag gtcgcctacg actcccagaa atgcatcgac
cactacgtgc agacggtggg cgccagccgc ccgtcggccg gcctcctcgg ctccgtccag tggctgccgc agctggtgat
gacgttgcca agccgccagc gcaccgccaa caagatcaag aagctcaagg cccgcgcgcg cgaggtgggg gagcggcggc
agaggtacgg cgtcaaagct ccgactcgga gcggcggcgt caaggtcatc accgcgccga tgctctcgcc GCAGCAGGAG
GCGGCGGAGC ACGCGCGGAG GCGCCGTGCC ATAGCTGACG CCACCGACTG GGTGAACACC GACGCGCAGC ACGTGATGGA
CTGGATAGCG GCCGGCGGCA AAGGACACAA CGACGATGAT GGTGGCCGGG AGGAGTACAT ACATTGGATC AAAGGCTTCC
TGCACATGCC CCACTTCACC ACCGAGAGCT TCTTGACGGA GCTCATGAGC AACAAGGCCG ATGCTACCGC CTTCTTGCTG
GAGTACACCA AAGAGTTGTT CGGAGGGCCG CTCCACTATT TGGAAGGGCA TTTGTTGTGG CCACATAAAG ATGATGGGCA
TGATAAGAAG GCCACGACGG CAGCGGCATC ATCCCCTTCT CAAGACCACC ACGATGCTGA CAAAAAGAAG CCAGTAGCAG
CTGCTGATCC GTCAGAGAGG GCCAAAGAAG CAGCTGTTGA TCCGTCTGGG AAGGCGAAGG AGCACAAGCG TTGGATCACC
CAAGGGGAGA AGAAAGCGGC GGACACGTCA ACCTCTTCAG AAGTCCATGA TTCTGCTGAG AAGAGGATGC CTTTAGCAGA
TGTTAATCCG TCGGAGATGG CGGAAGCATC ATCAGCTGAT GATGGACATA ACAAGGCAAC GGAAGGCCAT ACCAAAGAGT
TGTTCGGAGG GCCGCTCCAC TATTTGAAAG GGCATTTGTT GTGGCCACAT AAAGATGATG GGCATGATAA GAAGGCCACG
ACGGCAGCGG CATCATCCCC TTCTCAAGAC CACCACGATG CTGACAAAAA GAAGCCAGTA GCAGCTGCTG ATCCGTCAGA
GAGGGCCAAA GAGGAGAAGA AGCACCAGAT CATCAGTTGG GTACATGGAG CACTTACGAG CGACGGCATC AACATATTTC
ACACGAAAGA TACCCACGGC CCAAGGCTCC TCGCCATTGT TACATCACCG GTTCGTCGCG AGGCCCACGA CCTCGAAGAC
GAAGAACCAC ATGGGCTCAG GCCTGCAACA GAGATCGCAC GTAGGGTGTT CAATAATTAT TATTCCCGCC AAGGCGGCCG
CTTCGACTTT GCCGTGTGGG TCAACGCCGA GGAACACTCA CATAGCACCG CCAGGCTTCG GAGCATACTC CAGCAGGTGG
AGAAGCAGGC GCAGGTGCAG CCTCAGGAGC AGCGGCAGCA TCCATCATCT TCTTCTCGCG ATAAAAAAGA CGGTGGTGAC
GAGACGACAA GATTGCAACA GGAGATCCTA AAGCACCTGA CAGGGAAGAA GTTCTTGATT TTTCTTGCTG ACCACCAGGA
CGAAACACCA TGGACACAGA TACTACCTGC TCTGCCGACT GATAGCACCA ATGAAAGTGC AGTCATATTG AGTCCTCTGG
TGCAGCAAGC ATACCAGTAC GTTGGGTGGT ACGTGCTCAG CCTTTTCTTC TTGCTAAAGC ACTCCCGCTA TAGAGTCTAC
TTCTACTCTC ATCTTGTTGC AACACGGAAC AAGGCCAAAG AGTTGCTGCG GGTTGGCGCC GATCAACACA AAGGAGAAGA
TTTGCATGAC CTCGTCAATC ATATATTGGA ACGTTGTCGC TGGGATTCAT TTTCCAGCAA GATGTTTCTT CATGCTCTTT
ATGCTAATCA TCAAAGGAGC AAGCCAGAGC TGGAGAACTT GTTGCTTTCT CTGAATGAAT TCAGCACGGT GAGCAATGCC
AGAAACATGA TCAAATTTTG CTACGATGAC CTGCACAGTT ACAAGGTTTG CTTCCAGTAC CTGTCCATTT TCCCCTTGGG
ATTCAAGATC AGGAGGACAA GCTTGGTCAG GCGATGGGCT GCAGAAGGCC TTATCGTGGG AAGAGACGGG CTAGCTGCAA
CGGATGAAGC TGAGCGCTGC TTCGATGCCA TGATTGATCG AGGCCTTCTC CTTCCTGCCG ACAACACCGA CAACCCTTCA
GGCAAAGTGA AGATGTGCAC GGTCGATCCA CATGTTTTCT CCTTCATTGC CAGGTTGCAC AAAGACGATG GCCGTGCTCC
AGCTGCTGAT AGCATCGACC TGCCGCCCGC CCTGGCTCAT CGCATCTCCA TTGCCAGAAG AATTCAACTC TCCAACAAGA
CACGACAACG AGTCAGCGAG GGTTTGAAGA AGCAGATGGA CGGCGGTGGC GAGCCACAAG ACTCTGTCGC ACAAGGCATG
GTCTGTGGAA TTCAACTTTC CAACAAGACA CGACGACGAC AAGCCAGTGA GGGGTTGAAG AAGAAGATGG ACAGCAATGG
GGAGCCACTA GTCCCAGAGC CAAGATCGCA AGACTCTGCA GTGGAAGACG TGGTAAAGCT TCTTGACTTG TTTCCTACAA
CTGAATCAGG ATGGATCAAA GTGCTAGACC TTGAAGGCTG CCGTGGACTG AAGAAGAAGC ACCTCAAGAA CATCTGCAAC
AGGGTATTCC AGCTCAAGTA TCTGAGCTTA AGGAACACAG ACATTGCTGA GCTGCCCAAG GAAATTAACA AGCTCCAAGA
CCTGGAGACA TTTGACATGA GGGGAACCAA CATAGAATCC TTCCCTGCAA AATCCATTGT TCTCCCAAAG CTGGCGCGAC
TGCTTTCTGG TGTTGCTCAC ACCGACGCTC CAACTCCAAG TAAGGATGAT AATCTTACAA GTAGAGGATC TTCTCATGAA
TCATTTACTG CAATCCATAT TCCCCGTGGA ATCAAGAACA TGACAAGCAT GCAGATACTA TCCCATGTCC AAGTTTCTGA
CCATCACGAC GAGGCTGCAG CACTGGAAGA TTTAGCCCGG CTGCAGCTGC TATGGAAGCT TGGTGTTGTT ATCCATGCCA
AGCAAGCTTA CCTTGTGCTC AAAGTGGTTG GGATGCTAAA TGAATGCCTG AGGTCTTTGT CAATCCGTCT CCAAGATGGT
GGAGAGGATC CTGATCTGAA CAACACACCA CCAATATTCT CACCTCCAAG ATCTCTTGCA AGCCTTAGCA TCAGTGGCAG
GATAGGTGGC CTGCCTACTT GGATCCAAAA TCTGGAACAA CTCTCTGACA TAACTCTGTG CGACACCTCC TTGAAAGACT
CTGATATAAA GATCTTGTGT GCTAGTATCA ACCTGCGCTT CATCAGGCTC TTGCGTGAGT CGTACAACCA GAACAAGCTC
AGTTTTGAAA AGGGATTCAG AAACCTTGAG ATTCTCATCA TTGAGGGATC AGGCACCATC TCTGATGTCC ATTTTGATCC
GAGAGTGGCA CCTAAGCTTG AGAAGATTGT CTGGAGCTCC ACCTGCAAGA TGGAAAATCT TGGGATCGAC AACCTTCAAG
GACTGAAAGA GATTGTGCTC AAAGGCGACT GTGACCTGAA TCGCATCAGG CTATCCGTCA AAGCGAATCC ATGCCATCCT
AACCTTACAC ACACTCCAAC TCTCAACTCT CCAACAATCC AACCCGGTGA GGACACTGCA GCTGCAACCA GCACTTCGGC
AACAAACAAG TAG

Locus: Os11g0646300

Loading...

Locus: Os11g0646300

Loading...