Os11t0657400-01

Locus

Os11g0657400

Description

Leucine-rich repeat extensin-like protein, Lignin biosyntheis and deposition, Lodging resistance

RAP-DB Gene Symbol Synonym(s)

OsPEX1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PEX1

CGSNL Gene Name

POLLEN EXTENSIN 1

Oryzabase Gene Symbol Synonym(s)

OsPEX1

Oryzabase Gene Name Synonym(s)

Extensin family protein, pollen extensin 1

Transcript Evidence

tplb0004p13 (Wheat FLcDNA)

Protein Evidence

A0A0P0Y5A4

Literature

PMID: 30840202

Note

Manual Curation

June 5, 2020

Functional domain (InterPro)

Leucine-rich repeat domain superfamily (IPR032675)

Leucine-rich repeat-containing N-terminal, plant-type (IPR013210)

Expression Databases

TENOR (Os11t0657400-00)

Others

Oryzabase (21948)

Transcript

4231 bp

>Os11t0657400-01 Leucine-rich repeat extensin-like protein, Lignin biosyntheis and deposition, Lodging resistance
ATGGACCTCCGGCTCCTCCTCGCCCCCGGCGGGCGCCGCGCCGCCATGGCACTGATTCTC
GCCGTCCTCGCCGCCTGCCTCTCCTCCGCCGCCAACGTCGGCGCGGTGACCAGCGCCGAG
GTGTCGTACATCGCGCACCGGCAGCTGCTGGCGATGAAGGAGGCCGGCGTGAGCGAGGAG
GGCGACCTGCCGTCCGATGACTTCGACTTCGACGACCGCGTCGGAGTCGCCGTCGGCGAC
TTCCCGAACCCGCGGCTCCGCAAGGCGTACATCGCGCTCCAGGCGTGGCGGCGCGCGTTC
TACTCGGACCCCAAGGGGTACACCAACAACTGGACGGGCAACGACGTGTGCTCCTACAAC
GGCGTCATCTGCTACGCCGCCATCGACGACCCCAAGATCATGGTGGTCGCCGGCATCGAC
CTCAACGGCGCCGACATCGCCGGGTACCTCCCGCCGGAGCTCGGCCTCCTCACCGACCTC
GCCTTCTTCCACATCAACACCAACCGCTTCTGCGGCATCATCCCCAAGAGCATGTCGAGG
CTGTCGCTGCTGCACGAGTTCGACGTCAGCCACAACCGCTTCGTCGGCGTCTTCCCCCAC
GTCTGCCTCGAGATGGCCGTGCTCAAGTACCTCGACATCCGCTTCAACGACTTCGAGGGC
GAGCTGCCGCCGGCGCTGTTCGACAAGGAGCTCGACGCCATCTTCGTCAACAGCAACCGA
TTCGTCGGCTACATCCCGGGCAACCTCGGCAACTCCACCGCCTCCGTCATCGTCTTCGCC
AACAACGCCTTCGTCGGCTGCATCCCCAAGAGCATCGGCTGCATGGCCAAAACGCTCGAC
GAGATCAGCTTCATGAACAACAAGCTCGACGGCTGCGTGCCCATGGAGATGGGCTACCTG
CAGAACACCTACGTCATCGACATCAGCGGCAACGTCCTCGTCGGCACGCTGCCCACCTCG
CTCTCCAACTGCAGCAAGCTGGAGCAGCTGGACGTGTCCAGGAACGTCTTCACCGGCATC
GTCCACGAGTCCATCTGCGAGCTCCCCGTGCTCGTCAACTTCAGCTTCGCCTACAACTTC
TTCAACTCCGAGTCGGCGCCGTGCATGCCGTCGGAGAGCAGCAAGGTCAACCTCGACGAC
AAGGACAACTGCCTCGGCGCGCTCCGACCGGCGCAGAAGACGACGCTGCAGTGCGCCCCC
GTGCTCGCCCGCCCCGTCGACTGCAGCAAGCACGTCTGCCCCGGACACCCGACGCCCGGG
AAGCCGTCGGAGCCGCCGGAGAAGCCGCCGCTCATCCCGGTGCCGGTGGGGCCGCCGGAG
AAATCGCCGGCTTACGAGGAACCACCGGCCGCGCCTTCCACCCCGACGTCGCACGGCCCG
CCACCTCCAGAGGAGGAGTCACCTGAGGAACCACCCGAGGAACCAACACCGTCGCCGACA
CCAAGCAGCCCAGAGTCACCGGCCAAGATGGCGCCGCCTCCGGCACCCGCCATCAAGGGA
GTGACATCGCCGCCGGCAGAGTATGGTGCTCCACCGCCACCAAGTTCGGGTTGGCTCCCC
AAGAGTCCCGAGCGCAAGAAGGCACCTCCGCCACAAGCGGAGCCTCCTACTGAGTACTCC
CCACCTGCAACTCCAGAGAGCTCGCCACCACCTGAAGGGAAGTCCCCTCCTACGCCGACG
GCCTCGCACTCGCCACCACCGGTACCAGAGGGCCACACACCTTCCCCACCAAAGTCGGGA
CCACCTGCTGGGGAGTCTCCTCCTACACCTGAGTCAAAAGCCTCGCCTCCACCGACTCCA
GAAGAATACACACCTTCCCCGCCAAAATCGACACCACCAGCTGAGAAGTCTCCTCCTACA
CCTGAGTCGAAAGCCTCATCTCCACCACCACCCGCTCCAGAGGGCCACACACCTTCCCCG
CCAGAGTCGACACCACCATCTGAGAAATCTCCTCCTACACCCGAGTCGAAAGCCTCATCT
CCACCACCACCCACTCCAGAGGGCCACACACCTTCCCCGCCAAAGTCGACACCGCCAACT
GAGAAGTCTCCTCCTACACCTGAGTCGGAATCCTCCTCTCCACCACCACCCGCTCCAGAG
GGCCACATGCCTTCCCCGCCAAAGTCGACGCCACCAGTTGAGAAGTCTCCTCCCACGCCT
GAGTCGGAAGCCTCATCTCCACCACCACCCGCTCCGGAGGGCCACACACCTTCCCCACCA
AAGTCATCACCACCAGAAGAGAAGTCTCCTCCTATACCGCCGACCTCGCATACATCACCT
CCAACTCCAGAGGAATACACACCTTCCCCACCAAAGTCATCGCCACCAGAAGAGAAGTCT
CCTCCACCACATTCCCCAGAAAAGTCACCACCATCAGAGGCTCACCCAACTTCTCCACCT
CCCTCGGAGAAGTCACCTCCAACACCAGCTGAAGAGAGTTCTCCGCCAACTCCGGAAAAA
TCTCCATCACCACCATCGGGTCATGAAGGCACTCCACCATCCCCAGTGAAATCTTCCTCA
CCACCACCAGAAGCTCATGTTAGCTCACCACCACCAGAAAAATCTTCCTCGCCACCACCA
GAAGCTCATGTTAGTTCACCACCACCACCTGAAAAGTCTCCACCACCACCAGAGACAAAG
TCTCCACCAACGCTAACACCGGAGATCTCTCCACCTCCGGAAGGGAAGTCCCCACCATCA
CATACTCCGGAGAGCTCATCCCCACCATCTAAGGAGTCAGAACCACCACCGACACCAACA
CCAAAGAGCTCTCCACCATCTCACGAGGAGTACGTTCCTCCATCTCCGGCAAAATCAACT
CCACCTCCAGAAGAGAAGTCCCCACCATCACATACTCCGGAGAGCTCATCCCCACCATCT
GAGGAGTCAGAACCACCACCGTCACCAACACCAAAGAGCTCTCCACCATCTCACGAGGAG
TACGTTCCTCCATCTCCGGCGAAATCAACTCCACCTCCAGAAAAGCCACTACCACCACAC
ACACCAACAATAAATAGTTCTCCACCATCGGAAGAAGAGTACATGCCTCCATCTCCAGTG
AAATCAAGTCCACCACCAGCCGAGAAGTCCCAGCCACCGCCATCTCCAGTTGAGTCAGTA
CTTCCACCAGTGAAGTCTTCACCACCACACGCACCGGTTATCTCAGAACCACCACCAACA
AAGTCTTCACCGCCGCAAGTGCCAGTGACCTCGGAACCACCGCCAGCAAAGTCTTCACCT
CCACATGAACCAATTAGCCCGCCAGAAACACCAGAGAAGTCTTACCCGCCATCAACTCCT
GAGGAATCATCTCCTCCCTCAGTCCCCAAGGCTTCATCTCCACCAACTGAGAAGTCTCTT
CCTCCACCGGCTACAGTGAGCTTGCCGCCTCCAACAGTTAAGCCTTTGCCCCCACCGGTT
CCTGTGAGCTCACCGCCACCTCCGGAGAAGTCTCCACCCCCGCCAGCTCCGGTGATCTTG
CCGCCTCCTCCAATTAAATCTCCTCCCCCACCGGCTCCAGTCATCTCGCCACCTCCTCCA
GTTAAGTCCCCACCACCACCAGCACCAGTTATCTTGCCACCTCCTCCTGTGAAGTCTCCA
CCACCACCAGCACCGGTCATCTCGCCACCCCCACCTGTGAAGTCTCCACCTCCTCCCGCA
CCAGTCATCTTGCCACCCCCACCTGTGAAGTCTCCACCTCCACCTGCACCGGTCATCTCG
CCACCACCTCCAGAGAAGTCACCACCACCAGCAGCACCTGTGATCTTGTCACCACCAGCG
GTGAAGTCTCTTCCCCCACCGGCACCGGTCAGCCTACCACCACCACCGGTGAAGTCGCTT
CCCCCACCAGCACCGGTCAGCCTACCACCACCCGTCGTGAAGTCACTTCCCCCACCAGCA
CCAGTCAGCCTACCACCACCAGCGGTGAAGCCTCTTCCCCCACCAGCACCAGTCAGCCTA
CCACCACCAGCGGTGAAGCCTCTTCCCCCACCAGTTCCGCAGGTCTCCCTCCCCCCACCG
AAACAGGAGTCATTGCCGCCACCAGCAAAGGAAGCTGAAGCTCCACCTGCAAAGGAATCT
AAACCTCCACCAGCAATGGAAGCTGAAGCTCCACCGGCGTTCGACACTACTGTACTCTTA
CCGCCGGTGATGGCGCACCAGTACGCCTCACCTCCACCACCTCAGTTCCAAGGATACTAA
GCTCCATGGAGAGATTAACGACGACGACGAC

CDS

4200 bp

>Os11t0657400-01 Leucine-rich repeat extensin-like protein, Lignin biosyntheis and deposition, Lodging resistance
ATGGACCTCCGGCTCCTCCTCGCCCCCGGCGGGCGCCGCGCCGCCATGGCACTGATTCTC
GCCGTCCTCGCCGCCTGCCTCTCCTCCGCCGCCAACGTCGGCGCGGTGACCAGCGCCGAG
GTGTCGTACATCGCGCACCGGCAGCTGCTGGCGATGAAGGAGGCCGGCGTGAGCGAGGAG
GGCGACCTGCCGTCCGATGACTTCGACTTCGACGACCGCGTCGGAGTCGCCGTCGGCGAC
TTCCCGAACCCGCGGCTCCGCAAGGCGTACATCGCGCTCCAGGCGTGGCGGCGCGCGTTC
TACTCGGACCCCAAGGGGTACACCAACAACTGGACGGGCAACGACGTGTGCTCCTACAAC
GGCGTCATCTGCTACGCCGCCATCGACGACCCCAAGATCATGGTGGTCGCCGGCATCGAC
CTCAACGGCGCCGACATCGCCGGGTACCTCCCGCCGGAGCTCGGCCTCCTCACCGACCTC
GCCTTCTTCCACATCAACACCAACCGCTTCTGCGGCATCATCCCCAAGAGCATGTCGAGG
CTGTCGCTGCTGCACGAGTTCGACGTCAGCCACAACCGCTTCGTCGGCGTCTTCCCCCAC
GTCTGCCTCGAGATGGCCGTGCTCAAGTACCTCGACATCCGCTTCAACGACTTCGAGGGC
GAGCTGCCGCCGGCGCTGTTCGACAAGGAGCTCGACGCCATCTTCGTCAACAGCAACCGA
TTCGTCGGCTACATCCCGGGCAACCTCGGCAACTCCACCGCCTCCGTCATCGTCTTCGCC
AACAACGCCTTCGTCGGCTGCATCCCCAAGAGCATCGGCTGCATGGCCAAAACGCTCGAC
GAGATCAGCTTCATGAACAACAAGCTCGACGGCTGCGTGCCCATGGAGATGGGCTACCTG
CAGAACACCTACGTCATCGACATCAGCGGCAACGTCCTCGTCGGCACGCTGCCCACCTCG
CTCTCCAACTGCAGCAAGCTGGAGCAGCTGGACGTGTCCAGGAACGTCTTCACCGGCATC
GTCCACGAGTCCATCTGCGAGCTCCCCGTGCTCGTCAACTTCAGCTTCGCCTACAACTTC
TTCAACTCCGAGTCGGCGCCGTGCATGCCGTCGGAGAGCAGCAAGGTCAACCTCGACGAC
AAGGACAACTGCCTCGGCGCGCTCCGACCGGCGCAGAAGACGACGCTGCAGTGCGCCCCC
GTGCTCGCCCGCCCCGTCGACTGCAGCAAGCACGTCTGCCCCGGACACCCGACGCCCGGG
AAGCCGTCGGAGCCGCCGGAGAAGCCGCCGCTCATCCCGGTGCCGGTGGGGCCGCCGGAG
AAATCGCCGGCTTACGAGGAACCACCGGCCGCGCCTTCCACCCCGACGTCGCACGGCCCG
CCACCTCCAGAGGAGGAGTCACCTGAGGAACCACCCGAGGAACCAACACCGTCGCCGACA
CCAAGCAGCCCAGAGTCACCGGCCAAGATGGCGCCGCCTCCGGCACCCGCCATCAAGGGA
GTGACATCGCCGCCGGCAGAGTATGGTGCTCCACCGCCACCAAGTTCGGGTTGGCTCCCC
AAGAGTCCCGAGCGCAAGAAGGCACCTCCGCCACAAGCGGAGCCTCCTACTGAGTACTCC
CCACCTGCAACTCCAGAGAGCTCGCCACCACCTGAAGGGAAGTCCCCTCCTACGCCGACG
GCCTCGCACTCGCCACCACCGGTACCAGAGGGCCACACACCTTCCCCACCAAAGTCGGGA
CCACCTGCTGGGGAGTCTCCTCCTACACCTGAGTCAAAAGCCTCGCCTCCACCGACTCCA
GAAGAATACACACCTTCCCCGCCAAAATCGACACCACCAGCTGAGAAGTCTCCTCCTACA
CCTGAGTCGAAAGCCTCATCTCCACCACCACCCGCTCCAGAGGGCCACACACCTTCCCCG
CCAGAGTCGACACCACCATCTGAGAAATCTCCTCCTACACCCGAGTCGAAAGCCTCATCT
CCACCACCACCCACTCCAGAGGGCCACACACCTTCCCCGCCAAAGTCGACACCGCCAACT
GAGAAGTCTCCTCCTACACCTGAGTCGGAATCCTCCTCTCCACCACCACCCGCTCCAGAG
GGCCACATGCCTTCCCCGCCAAAGTCGACGCCACCAGTTGAGAAGTCTCCTCCCACGCCT
GAGTCGGAAGCCTCATCTCCACCACCACCCGCTCCGGAGGGCCACACACCTTCCCCACCA
AAGTCATCACCACCAGAAGAGAAGTCTCCTCCTATACCGCCGACCTCGCATACATCACCT
CCAACTCCAGAGGAATACACACCTTCCCCACCAAAGTCATCGCCACCAGAAGAGAAGTCT
CCTCCACCACATTCCCCAGAAAAGTCACCACCATCAGAGGCTCACCCAACTTCTCCACCT
CCCTCGGAGAAGTCACCTCCAACACCAGCTGAAGAGAGTTCTCCGCCAACTCCGGAAAAA
TCTCCATCACCACCATCGGGTCATGAAGGCACTCCACCATCCCCAGTGAAATCTTCCTCA
CCACCACCAGAAGCTCATGTTAGCTCACCACCACCAGAAAAATCTTCCTCGCCACCACCA
GAAGCTCATGTTAGTTCACCACCACCACCTGAAAAGTCTCCACCACCACCAGAGACAAAG
TCTCCACCAACGCTAACACCGGAGATCTCTCCACCTCCGGAAGGGAAGTCCCCACCATCA
CATACTCCGGAGAGCTCATCCCCACCATCTAAGGAGTCAGAACCACCACCGACACCAACA
CCAAAGAGCTCTCCACCATCTCACGAGGAGTACGTTCCTCCATCTCCGGCAAAATCAACT
CCACCTCCAGAAGAGAAGTCCCCACCATCACATACTCCGGAGAGCTCATCCCCACCATCT
GAGGAGTCAGAACCACCACCGTCACCAACACCAAAGAGCTCTCCACCATCTCACGAGGAG
TACGTTCCTCCATCTCCGGCGAAATCAACTCCACCTCCAGAAAAGCCACTACCACCACAC
ACACCAACAATAAATAGTTCTCCACCATCGGAAGAAGAGTACATGCCTCCATCTCCAGTG
AAATCAAGTCCACCACCAGCCGAGAAGTCCCAGCCACCGCCATCTCCAGTTGAGTCAGTA
CTTCCACCAGTGAAGTCTTCACCACCACACGCACCGGTTATCTCAGAACCACCACCAACA
AAGTCTTCACCGCCGCAAGTGCCAGTGACCTCGGAACCACCGCCAGCAAAGTCTTCACCT
CCACATGAACCAATTAGCCCGCCAGAAACACCAGAGAAGTCTTACCCGCCATCAACTCCT
GAGGAATCATCTCCTCCCTCAGTCCCCAAGGCTTCATCTCCACCAACTGAGAAGTCTCTT
CCTCCACCGGCTACAGTGAGCTTGCCGCCTCCAACAGTTAAGCCTTTGCCCCCACCGGTT
CCTGTGAGCTCACCGCCACCTCCGGAGAAGTCTCCACCCCCGCCAGCTCCGGTGATCTTG
CCGCCTCCTCCAATTAAATCTCCTCCCCCACCGGCTCCAGTCATCTCGCCACCTCCTCCA
GTTAAGTCCCCACCACCACCAGCACCAGTTATCTTGCCACCTCCTCCTGTGAAGTCTCCA
CCACCACCAGCACCGGTCATCTCGCCACCCCCACCTGTGAAGTCTCCACCTCCTCCCGCA
CCAGTCATCTTGCCACCCCCACCTGTGAAGTCTCCACCTCCACCTGCACCGGTCATCTCG
CCACCACCTCCAGAGAAGTCACCACCACCAGCAGCACCTGTGATCTTGTCACCACCAGCG
GTGAAGTCTCTTCCCCCACCGGCACCGGTCAGCCTACCACCACCACCGGTGAAGTCGCTT
CCCCCACCAGCACCGGTCAGCCTACCACCACCCGTCGTGAAGTCACTTCCCCCACCAGCA
CCAGTCAGCCTACCACCACCAGCGGTGAAGCCTCTTCCCCCACCAGCACCAGTCAGCCTA
CCACCACCAGCGGTGAAGCCTCTTCCCCCACCAGTTCCGCAGGTCTCCCTCCCCCCACCG
AAACAGGAGTCATTGCCGCCACCAGCAAAGGAAGCTGAAGCTCCACCTGCAAAGGAATCT
AAACCTCCACCAGCAATGGAAGCTGAAGCTCCACCGGCGTTCGACACTACTGTACTCTTA
CCGCCGGTGATGGCGCACCAGTACGCCTCACCTCCACCACCTCAGTTCCAAGGATACTAA

Protein

1400 aa

>Os11t0657400-01 Leucine-rich repeat extensin-like protein, Lignin biosyntheis and deposition, Lodging resistance
MDLRLLLAPGGRRAAMALILAVLAACLSSAANVGAVTSAEVSYIAHRQLLAMKEAGVSEE
GDLPSDDFDFDDRVGVAVGDFPNPRLRKAYIALQAWRRAFYSDPKGYTNNWTGNDVCSYN
GVICYAAIDDPKIMVVAGIDLNGADIAGYLPPELGLLTDLAFFHINTNRFCGIIPKSMSR
LSLLHEFDVSHNRFVGVFPHVCLEMAVLKYLDIRFNDFEGELPPALFDKELDAIFVNSNR
FVGYIPGNLGNSTASVIVFANNAFVGCIPKSIGCMAKTLDEISFMNNKLDGCVPMEMGYL
QNTYVIDISGNVLVGTLPTSLSNCSKLEQLDVSRNVFTGIVHESICELPVLVNFSFAYNF
FNSESAPCMPSESSKVNLDDKDNCLGALRPAQKTTLQCAPVLARPVDCSKHVCPGHPTPG
KPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHGPPPPEEESPEEPPEEPTPSPT
PSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPPSSGWLPKSPERKKAPPPQAEPPTEYS
PPATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTPESKASPPPTP
EEYTPSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKASS
PPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPTP
ESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKS
PPPHSPEKSPPSEAHPTSPPPSEKSPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSS
PPPEAHVSSPPPEKSSSPPPEAHVSSPPPPEKSPPPPETKSPPTLTPEISPPPEGKSPPS
HTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSPAKSTPPPEEKSPPSHTPESSSPPS
EESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPPEKPLPPHTPTINSSPPSEEEYMPPSPV
KSSPPPAEKSQPPPSPVESVLPPVKSSPPHAPVISEPPPTKSSPPQVPVTSEPPPAKSSP
PHEPISPPETPEKSYPPSTPEESSPPSVPKASSPPTEKSLPPPATVSLPPPTVKPLPPPV
PVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSP
PPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPA
VKSLPPPAPVSLPPPPVKSLPPPAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAPVSL
PPPAVKPLPPPVPQVSLPPPKQESLPPPAKEAEAPPAKESKPPPAMEAEAPPAFDTTVLL
PPVMAHQYASPPPPQFQGY*

CDS

chr11:26317304..26321503 (- strand) : 4200 bp

3'UTR

chr11:26317273..26317303 (- strand) : 31 bp

FASTA

>Os11t0657400-01 class=Sequence position=chr11:26317273..26321503 (- strand)
ATGGACCTCC GGCTCCTCCT CGCCCCCGGC GGGCGCCGCG CCGCCATGGC ACTGATTCTC GCCGTCCTCG CCGCCTGCCT
CTCCTCCGCC GCCAACGTCG GCGCGGTGAC CAGCGCCGAG GTGTCGTACA TCGCGCACCG GCAGCTGCTG GCGATGAAGG
AGGCCGGCGT GAGCGAGGAG GGCGACCTGC CGTCCGATGA CTTCGACTTC GACGACCGCG TCGGAGTCGC CGTCGGCGAC
TTCCCGAACC CGCGGCTCCG CAAGGCGTAC ATCGCGCTCC AGGCGTGGCG GCGCGCGTTC TACTCGGACC CCAAGGGGTA
CACCAACAAC TGGACGGGCA ACGACGTGTG CTCCTACAAC GGCGTCATCT GCTACGCCGC CATCGACGAC CCCAAGATCA
TGGTGGTCGC CGGCATCGAC CTCAACGGCG CCGACATCGC CGGGTACCTC CCGCCGGAGC TCGGCCTCCT CACCGACCTC
GCCTTCTTCC ACATCAACAC CAACCGCTTC TGCGGCATCA TCCCCAAGAG CATGTCGAGG CTGTCGCTGC TGCACGAGTT
CGACGTCAGC CACAACCGCT TCGTCGGCGT CTTCCCCCAC GTCTGCCTCG AGATGGCCGT GCTCAAGTAC CTCGACATCC
GCTTCAACGA CTTCGAGGGC GAGCTGCCGC CGGCGCTGTT CGACAAGGAG CTCGACGCCA TCTTCGTCAA CAGCAACCGA
TTCGTCGGCT ACATCCCGGG CAACCTCGGC AACTCCACCG CCTCCGTCAT CGTCTTCGCC AACAACGCCT TCGTCGGCTG
CATCCCCAAG AGCATCGGCT GCATGGCCAA AACGCTCGAC GAGATCAGCT TCATGAACAA CAAGCTCGAC GGCTGCGTGC
CCATGGAGAT GGGCTACCTG CAGAACACCT ACGTCATCGA CATCAGCGGC AACGTCCTCG TCGGCACGCT GCCCACCTCG
CTCTCCAACT GCAGCAAGCT GGAGCAGCTG GACGTGTCCA GGAACGTCTT CACCGGCATC GTCCACGAGT CCATCTGCGA
GCTCCCCGTG CTCGTCAACT TCAGCTTCGC CTACAACTTC TTCAACTCCG AGTCGGCGCC GTGCATGCCG TCGGAGAGCA
GCAAGGTCAA CCTCGACGAC AAGGACAACT GCCTCGGCGC GCTCCGACCG GCGCAGAAGA CGACGCTGCA GTGCGCCCCC
GTGCTCGCCC GCCCCGTCGA CTGCAGCAAG CACGTCTGCC CCGGACACCC GACGCCCGGG AAGCCGTCGG AGCCGCCGGA
GAAGCCGCCG CTCATCCCGG TGCCGGTGGG GCCGCCGGAG AAATCGCCGG CTTACGAGGA ACCACCGGCC GCGCCTTCCA
CCCCGACGTC GCACGGCCCG CCACCTCCAG AGGAGGAGTC ACCTGAGGAA CCACCCGAGG AACCAACACC GTCGCCGACA
CCAAGCAGCC CAGAGTCACC GGCCAAGATG GCGCCGCCTC CGGCACCCGC CATCAAGGGA GTGACATCGC CGCCGGCAGA
GTATGGTGCT CCACCGCCAC CAAGTTCGGG TTGGCTCCCC AAGAGTCCCG AGCGCAAGAA GGCACCTCCG CCACAAGCGG
AGCCTCCTAC TGAGTACTCC CCACCTGCAA CTCCAGAGAG CTCGCCACCA CCTGAAGGGA AGTCCCCTCC TACGCCGACG
GCCTCGCACT CGCCACCACC GGTACCAGAG GGCCACACAC CTTCCCCACC AAAGTCGGGA CCACCTGCTG GGGAGTCTCC
TCCTACACCT GAGTCAAAAG CCTCGCCTCC ACCGACTCCA GAAGAATACA CACCTTCCCC GCCAAAATCG ACACCACCAG
CTGAGAAGTC TCCTCCTACA CCTGAGTCGA AAGCCTCATC TCCACCACCA CCCGCTCCAG AGGGCCACAC ACCTTCCCCG
CCAGAGTCGA CACCACCATC TGAGAAATCT CCTCCTACAC CCGAGTCGAA AGCCTCATCT CCACCACCAC CCACTCCAGA
GGGCCACACA CCTTCCCCGC CAAAGTCGAC ACCGCCAACT GAGAAGTCTC CTCCTACACC TGAGTCGGAA TCCTCCTCTC
CACCACCACC CGCTCCAGAG GGCCACATGC CTTCCCCGCC AAAGTCGACG CCACCAGTTG AGAAGTCTCC TCCCACGCCT
GAGTCGGAAG CCTCATCTCC ACCACCACCC GCTCCGGAGG GCCACACACC TTCCCCACCA AAGTCATCAC CACCAGAAGA
GAAGTCTCCT CCTATACCGC CGACCTCGCA TACATCACCT CCAACTCCAG AGGAATACAC ACCTTCCCCA CCAAAGTCAT
CGCCACCAGA AGAGAAGTCT CCTCCACCAC ATTCCCCAGA AAAGTCACCA CCATCAGAGG CTCACCCAAC TTCTCCACCT
CCCTCGGAGA AGTCACCTCC AACACCAGCT GAAGAGAGTT CTCCGCCAAC TCCGGAAAAA TCTCCATCAC CACCATCGGG
TCATGAAGGC ACTCCACCAT CCCCAGTGAA ATCTTCCTCA CCACCACCAG AAGCTCATGT TAGCTCACCA CCACCAGAAA
AATCTTCCTC GCCACCACCA GAAGCTCATG TTAGTTCACC ACCACCACCT GAAAAGTCTC CACCACCACC AGAGACAAAG
TCTCCACCAA CGCTAACACC GGAGATCTCT CCACCTCCGG AAGGGAAGTC CCCACCATCA CATACTCCGG AGAGCTCATC
CCCACCATCT AAGGAGTCAG AACCACCACC GACACCAACA CCAAAGAGCT CTCCACCATC TCACGAGGAG TACGTTCCTC
CATCTCCGGC AAAATCAACT CCACCTCCAG AAGAGAAGTC CCCACCATCA CATACTCCGG AGAGCTCATC CCCACCATCT
GAGGAGTCAG AACCACCACC GTCACCAACA CCAAAGAGCT CTCCACCATC TCACGAGGAG TACGTTCCTC CATCTCCGGC
GAAATCAACT CCACCTCCAG AAAAGCCACT ACCACCACAC ACACCAACAA TAAATAGTTC TCCACCATCG GAAGAAGAGT
ACATGCCTCC ATCTCCAGTG AAATCAAGTC CACCACCAGC CGAGAAGTCC CAGCCACCGC CATCTCCAGT TGAGTCAGTA
CTTCCACCAG TGAAGTCTTC ACCACCACAC GCACCGGTTA TCTCAGAACC ACCACCAACA AAGTCTTCAC CGCCGCAAGT
GCCAGTGACC TCGGAACCAC CGCCAGCAAA GTCTTCACCT CCACATGAAC CAATTAGCCC GCCAGAAACA CCAGAGAAGT
CTTACCCGCC ATCAACTCCT GAGGAATCAT CTCCTCCCTC AGTCCCCAAG GCTTCATCTC CACCAACTGA GAAGTCTCTT
CCTCCACCGG CTACAGTGAG CTTGCCGCCT CCAACAGTTA AGCCTTTGCC CCCACCGGTT CCTGTGAGCT CACCGCCACC
TCCGGAGAAG TCTCCACCCC CGCCAGCTCC GGTGATCTTG CCGCCTCCTC CAATTAAATC TCCTCCCCCA CCGGCTCCAG
TCATCTCGCC ACCTCCTCCA GTTAAGTCCC CACCACCACC AGCACCAGTT ATCTTGCCAC CTCCTCCTGT GAAGTCTCCA
CCACCACCAG CACCGGTCAT CTCGCCACCC CCACCTGTGA AGTCTCCACC TCCTCCCGCA CCAGTCATCT TGCCACCCCC
ACCTGTGAAG TCTCCACCTC CACCTGCACC GGTCATCTCG CCACCACCTC CAGAGAAGTC ACCACCACCA GCAGCACCTG
TGATCTTGTC ACCACCAGCG GTGAAGTCTC TTCCCCCACC GGCACCGGTC AGCCTACCAC CACCACCGGT GAAGTCGCTT
CCCCCACCAG CACCGGTCAG CCTACCACCA CCCGTCGTGA AGTCACTTCC CCCACCAGCA CCAGTCAGCC TACCACCACC
AGCGGTGAAG CCTCTTCCCC CACCAGCACC AGTCAGCCTA CCACCACCAG CGGTGAAGCC TCTTCCCCCA CCAGTTCCGC
AGGTCTCCCT CCCCCCACCG AAACAGGAGT CATTGCCGCC ACCAGCAAAG GAAGCTGAAG CTCCACCTGC AAAGGAATCT
AAACCTCCAC CAGCAATGGA AGCTGAAGCT CCACCGGCGT TCGACACTAC TGTACTCTTA CCGCCGGTGA TGGCGCACCA
GTACGCCTCA CCTCCACCAC CTCAGTTCCA AGGATACTAA GCTCCATGGA GAGATTAACG ACGACGACGA C

Locus: Os11g0657400

Loading...

Locus: Os11g0657400

Loading...