Os11t0660300-01

Locus

Os11g0660300

Description

WD40 repeat-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RBP10

CGSNL Gene Name

RNA-BINDING PROTEIN 10

Oryzabase Gene Symbol Synonym(s)

OsRBP10, RBP-10, OsRBP-10

Oryzabase Gene Name Synonym(s)

RNA-Binding Protein 10

Transcript Evidence

AK109657 (DDBJ, Best hit)

Protein Evidence

A4GZL2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

G-protein beta WD-40 repeat (IPR020472)

Full-length cDNA

002-140-F06 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0660300-01)

RiceXPro (AK109657)

Others

Oryzabase (22719)

KEGG (Os11t0660300-01)

Transcript

1205 bp

>Os11t0660300-01 WD40 repeat-like domain containing protein.
AAAACCCACGAACCCCTCGTCTCTCTCACTCCCCTCCCCAACCAGATCAAACGCTAGGGT
TTCCTCGACTTCGACTTCGTCTTCCTCCTCGAGCAGAGCAGCAGCAGAGATGAAGCTCGC
GGGGCTCAAGTCGGTGGACGGGGCCCACGAGGAGTCCATCTGGGCGGCGGCGTGGGTGCC
CGCGGCGGACCACCGCCCCGCGGCGCTGCTCCTGACGGGCGCCCTCGACGAGACCGTCCG
CCTCTGGGCCCCCGACGACCTCGCCTCCGCCGCCGCCTCCCCCTCGCGGGGCCACGCGCT
CGGGGTGGTGTCGCTCGCCGCCCACCCCGCGGGCGCCGTCGCCGCCGCCGTCTCCCTCGA
CAGCTACGTCCGCGTCTTCGATGTGGACTCGGGCTCCTCCGTCGCCACGCTCGAGGCCCC
TCCCTCCGAGGTCTGGGGCATCCAGTTCCACCCCAAGGGTAGTGCTCTGGCTGCAGCTGG
TGGTGGCAGTGGATCAGTGAAGCTCTGGGACACAGAGAAGTGGAAGCCAATTACCAGCCT
TGCTGTTCCGCGTCCAGAGGGAGCTCGCCCTGATAAAACAGGAAGCGGCAAGTTTGTCCT
TTCAGTTGCATGGAGTCCTGATGGCAAGCTCTTAGCTTGTGGTTCCATGGATGGCACCAT
CGCTGTGTATGACGCAGTTCGCATGAAGTTCCTCCACCACCTTGAGGGCCATCACATGCC
AGTGAGATCAATGGTGTTCTCTCCAGTGGACCCGCACGTGCTCTTCACTGCCTCCGACGA
TTGCCACATCCACATATACGACGCCAAGGAGAAGAGCCTCATTGGGGCCATGTCAGGGCA
TGCGAGCTGGGTGCTGAGCATCGACGTGAGCCCAGACGGCATGGCGGTAGCGACAGGCTC
CAGTGACCGCACGGTCCGGCTTTGGGACATCAACACGAGGGCGTCGGTGCAGACGATGAG
CAACCACAATGATCAGGTCTGGGCTGTCGCCTTCCGACCACCGGGTGGGACAGGAGTCCG
CGCAGGCCGGCTTGCCAGCGTGTCAGATGACAAGAGCATCACCCTGTACGATTACTCATA
GTTTTAACACTGCAACCTGCAACTTCATTGTAGTCAGCTGTTTCCAACTTGCATTGGAAA
AAAAAACCTGTTGTACAATCCTAATTAAGCTCATGAGTTGCAAGTAGAGTGCGTTTATTT
CCAGT

CDS

972 bp

>Os11t0660300-01 WD40 repeat-like domain containing protein.
ATGAAGCTCGCGGGGCTCAAGTCGGTGGACGGGGCCCACGAGGAGTCCATCTGGGCGGCG
GCGTGGGTGCCCGCGGCGGACCACCGCCCCGCGGCGCTGCTCCTGACGGGCGCCCTCGAC
GAGACCGTCCGCCTCTGGGCCCCCGACGACCTCGCCTCCGCCGCCGCCTCCCCCTCGCGG
GGCCACGCGCTCGGGGTGGTGTCGCTCGCCGCCCACCCCGCGGGCGCCGTCGCCGCCGCC
GTCTCCCTCGACAGCTACGTCCGCGTCTTCGATGTGGACTCGGGCTCCTCCGTCGCCACG
CTCGAGGCCCCTCCCTCCGAGGTCTGGGGCATCCAGTTCCACCCCAAGGGTAGTGCTCTG
GCTGCAGCTGGTGGTGGCAGTGGATCAGTGAAGCTCTGGGACACAGAGAAGTGGAAGCCA
ATTACCAGCCTTGCTGTTCCGCGTCCAGAGGGAGCTCGCCCTGATAAAACAGGAAGCGGC
AAGTTTGTCCTTTCAGTTGCATGGAGTCCTGATGGCAAGCTCTTAGCTTGTGGTTCCATG
GATGGCACCATCGCTGTGTATGACGCAGTTCGCATGAAGTTCCTCCACCACCTTGAGGGC
CATCACATGCCAGTGAGATCAATGGTGTTCTCTCCAGTGGACCCGCACGTGCTCTTCACT
GCCTCCGACGATTGCCACATCCACATATACGACGCCAAGGAGAAGAGCCTCATTGGGGCC
ATGTCAGGGCATGCGAGCTGGGTGCTGAGCATCGACGTGAGCCCAGACGGCATGGCGGTA
GCGACAGGCTCCAGTGACCGCACGGTCCGGCTTTGGGACATCAACACGAGGGCGTCGGTG
CAGACGATGAGCAACCACAATGATCAGGTCTGGGCTGTCGCCTTCCGACCACCGGGTGGG
ACAGGAGTCCGCGCAGGCCGGCTTGCCAGCGTGTCAGATGACAAGAGCATCACCCTGTAC
GATTACTCATAG

Protein

324 aa

>Os11t0660300-01 WD40 repeat-like domain containing protein.
MKLAGLKSVDGAHEESIWAAAWVPAADHRPAALLLTGALDETVRLWAPDDLASAAASPSR
GHALGVVSLAAHPAGAVAAAVSLDSYVRVFDVDSGSSVATLEAPPSEVWGIQFHPKGSAL
AAAGGGSGSVKLWDTEKWKPITSLAVPRPEGARPDKTGSGKFVLSVAWSPDGKLLACGSM
DGTIAVYDAVRMKFLHHLEGHHMPVRSMVFSPVDPHVLFTASDDCHIHIYDAKEKSLIGA
MSGHASWVLSIDVSPDGMAVATGSSDRTVRLWDINTRASVQTMSNHNDQVWAVAFRPPGG
TGVRAGRLASVSDDKSITLYDYS*

5'UTR

chr11:26501646..26501754 (+ strand) : 109 bp

CDS

chr11:26501755..26502102 (+ strand) : 348 bp

chr11:26503464..26504087 (+ strand) : 624 bp

3'UTR

chr11:26504088..26504211 (+ strand) : 124 bp

FASTA

>Os11t0660300-01 class=Sequence position=chr11:26501646..26504211 (+ strand)
AAAACCCACG AACCCCTCGT CTCTCTCACT CCCCTCCCCA ACCAGATCAA ACGCTAGGGT TTCCTCGACT TCGACTTCGT
CTTCCTCCTC GAGCAGAGCA GCAGCAGAGA TGAAGCTCGC GGGGCTCAAG TCGGTGGACG GGGCCCACGA GGAGTCCATC
TGGGCGGCGG CGTGGGTGCC CGCGGCGGAC CACCGCCCCG CGGCGCTGCT CCTGACGGGC GCCCTCGACG AGACCGTCCG
CCTCTGGGCC CCCGACGACC TCGCCTCCGC CGCCGCCTCC CCCTCGCGGG GCCACGCGCT CGGGGTGGTG TCGCTCGCCG
CCCACCCCGC GGGCGCCGTC GCCGCCGCCG TCTCCCTCGA CAGCTACGTC CGCGTCTTCG ATGTGGACTC GGGCTCCTCC
GTCGCCACGC TCGAGGCCCC TCCCTCCGAG GTCTGGGGCA TCCAGTTCCA CCCCAAGGTA GGTGATGATC CTACCCCCCA
CCCCACCATC TTTGCTTTGC GATTCACATT CTGAGGTTGC TTGACTAGAT TCGTTGTGTG GGGGAGATGT GAGAGGCGTG
GGATTTCAGT GTGATAATGT GGTAATTACA GTTGATTCGA GCATCATTTC CATCTGTTGT ATGGGTTTGT ATAGTTTGGA
ATATGTCTAG TGTGGTTTTT TTTACCTAGT GTAATGTGTG ATCTTTTCTC AGATGTTTTA GTAGATTTTA GTATCATTTT
AACTGAAACT TCATGACAAA AGTGTGGCCT TGATTGGCAC TTTGTGGTAG TTTTATTAGA TTTAAAGAAA ATAAAGGAAT
CTAAAAGAAT GTTTTCGCAA AGTTAAGGAA TATATGCAAA GTGATCATTT CAATTTTCGA GCAGTTCAAA TACGCAATTG
ATGACTGAGG TTTGGTTGTT AAATTCGGTG GGCAAGTCTG ACAGTATATT CAGTTGTTAC TGCTTATTAT CATTGACCAC
AGTACCTCAC TTTTGTGGAA TAGCGCTCCT TCATCTCAAC ACTGCAACAA ATTTAGTAAT CGCTTTGAAG AGGATCATCA
TGTGAAGTAT GGTGTTTCAT GCATTGCTGG CAAAGTGTGT GCAACATTTA CTGCATAGTC GCTTAGACTC TGAGAATAAT
GTTGAATCCT ACCTTTTCGA TTCTCTTTCA GACTCAGTAA ATTAAGCGAC AATTAATTGT GTATCCAAAC TCATTGGACA
TATTTTTATC ATAGTTACAG GTTTTGCATA GGTCCTGTTT TCATGCTTCC TTTGTATTTT AAAAATTGAT TTGTATTCAT
GTTTTTCACA ATATGCCAGA TAATTATCTA TTTGGGTAAC CCACCTTTCT GTGCAAGATG ACTAAACATC ACTACGCCCA
TTGCAATCAC TGCCAGAAAT GGTTTGTCAA AGTAGCGTAT CTGTGGTCAA TTCATTTTCA TATTGCCTTG TTGTGATTCA
TCTTGCTAAT TTCCAGAACA TACTATTTTT CTTAAATGAT ATTTTGGTAT GTACTAAACC TTGCTAGAAT TGACCTATGG
CCTTAAGACA TTATTTATTT TCTTCCATAA ACGTGTTGAT ACAATTATGT CTAATTCAAT GAGAATCGGA GATGCTTGTT
CAAGCTTGTC TTCTCACTTG CAGTTGAGAC GTGTTACGCA TTCAGCGTTT TCCACTGTGC TATCTCTATA TACCTTTGTT
GACAGCATAT ACTAATTTTT CTAAAACCTG CAGTACCAGG AATTAACCTC CTTTTATGGT AGCCTCACTT TACTGAAGGT
CTTCACTTGT TCTAGCTACT GACATTATTA CCTCACCCAC AAATGCTTTC CTTCACAGGG TAGTGCTCTG GCTGCAGCTG
GTGGTGGCAG TGGATCAGTG AAGCTCTGGG ACACAGAGAA GTGGAAGCCA ATTACCAGCC TTGCTGTTCC GCGTCCAGAG
GGAGCTCGCC CTGATAAAAC AGGAAGCGGC AAGTTTGTCC TTTCAGTTGC ATGGAGTCCT GATGGCAAGC TCTTAGCTTG
TGGTTCCATG GATGGCACCA TCGCTGTGTA TGACGCAGTT CGCATGAAGT TCCTCCACCA CCTTGAGGGC CATCACATGC
CAGTGAGATC AATGGTGTTC TCTCCAGTGG ACCCGCACGT GCTCTTCACT GCCTCCGACG ATTGCCACAT CCACATATAC
GACGCCAAGG AGAAGAGCCT CATTGGGGCC ATGTCAGGGC ATGCGAGCTG GGTGCTGAGC ATCGACGTGA GCCCAGACGG
CATGGCGGTA GCGACAGGCT CCAGTGACCG CACGGTCCGG CTTTGGGACA TCAACACGAG GGCGTCGGTG CAGACGATGA
GCAACCACAA TGATCAGGTC TGGGCTGTCG CCTTCCGACC ACCGGGTGGG ACAGGAGTCC GCGCAGGCCG GCTTGCCAGC
GTGTCAGATG ACAAGAGCAT CACCCTGTAC GATTACTCAT AGTTTTAACA CTGCAACCTG CAACTTCATT GTAGTCAGCT
GTTTCCAACT TGCATTGGAA AAAAAAACCT GTTGTACAAT CCTAATTAAG CTCATGAGTT GCAAGTAGAG TGCGTTTATT
TCCAGT